Lineage for d5tmxb1 (5tmx B:7-63)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1993627Fold a.34: Dimerisation interlock [47405] (4 superfamilies)
    4 helices; bundle, closed, right-handed twist
  4. 1993628Superfamily a.34.1: SinR repressor dimerisation domain-like [47406] (1 family) (S)
    intertwined heterodimer of two homologous chains
  5. 1993629Family a.34.1.1: SinR repressor dimerisation domain-like [47407] (3 protein domains)
  6. 2297329Protein automated matches [340630] (1 species)
    not a true protein
  7. 2297330Species Bacillus subtilis [TaxId:224308] [340631] (1 PDB entry)
  8. 2297364Domain d5tmxb1: 5tmx B:7-63 [340665]
    Other proteins in same PDB: d5tmxa2, d5tmxb2
    automated match to d1b0nb_

Details for d5tmxb1

PDB Entry: 5tmx (more details)

PDB Description: solution structure of sini, antagonist to the master biofilm-regulator sinr in bacillus subtilis
PDB Compounds: (B:) Protein SinI

SCOPe Domain Sequences for d5tmxb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5tmxb1 a.34.1.1 (B:7-63) automated matches {Bacillus subtilis [TaxId: 224308]}
mknakqehfeldqewvelmveakeanispeeirkylllnkksahpgpaarshtvnpf

SCOPe Domain Coordinates for d5tmxb1:

Click to download the PDB-style file with coordinates for d5tmxb1.
(The format of our PDB-style files is described here.)

Timeline for d5tmxb1:

  • d5tmxb1 appears in periodic updates to SCOPe 2.06 starting on 2017-10-29

View in 3D
Domains from same chain:
(mouse over for more information)
d5tmxb2