Lineage for d5oasa1 (5oas A:1-725)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2088435Superfamily c.1.13: Malate synthase G [51645] (1 family) (S)
  5. 2088436Family c.1.13.1: Malate synthase G [51646] (2 protein domains)
  6. 2088450Protein automated matches [195320] (6 species)
    not a true protein
  7. 2289994Species Pseudomonas aeruginosa [TaxId:208964] [333295] (2 PDB entries)
  8. 2297360Domain d5oasa1: 5oas A:1-725 [340661]
    Other proteins in same PDB: d5oasa2
    automated match to d3s9za_
    complexed with edo, gol, mg

Details for d5oasa1

PDB Entry: 5oas (more details), 1.62 Å

PDB Description: crystal structure of malate synthase g from pseudomonas aeruginosa in apo form.
PDB Compounds: (A:) malate synthase g

SCOPe Domain Sequences for d5oasa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5oasa1 c.1.13.1 (A:1-725) automated matches {Pseudomonas aeruginosa [TaxId: 208964]}
mtervqvgglqvakvlfdfvnneaipgtgvsadtfwtgaeavindlapknkallakrdel
qakidgwhqaragqahdavaykafleeigyllpeaedfqagtqnvddeiarmagpqlvvp
vmnarfalnasnarwgslydalygtdviseeggaekgkgynkvrgdkviafarafldeaa
plesgshvdatsysvkngalvvalkngsetglknagqflafqgdaakpqavllkhnglhf
eiqidpsspvgqtdaagvkdvlmeaalttimdcedsvaavdaddkvviyrnwlglmkgdl
aeevskggstftrtmnpdrvytradgseltlhgrsllfvrnvghlmtndaildkdgnevp
egiqdglftsliaihdlngntsrknsrtgsvyivkpkmhgpeeaaftnelfgrvedvlgl
prntlkvgimdeerrttvnlkacikaakdrvvfintgfldrtgdeihtsmeagavvrkga
mksekwigayennnvdvglatglqgkaqigkgmwampdlmaamleqkighplagantawv
psptaatlhalhyhkvdvfarqaelakrtpasvddiltiplapntnwtaeeiknevdnna
qgilgyvvrwidqgvgcskvpdindvglmedratlrissqllanwlrhgvisqeqvvesl
krmavvvdrqnasdpsyrpmapnfddnvafqaalelvvegtrqpngytepvlhrrrrefk
akngl

SCOPe Domain Coordinates for d5oasa1:

Click to download the PDB-style file with coordinates for d5oasa1.
(The format of our PDB-style files is described here.)

Timeline for d5oasa1:

  • d5oasa1 appears in periodic updates to SCOPe 2.06 starting on 2017-10-29

View in 3D
Domains from same chain:
(mouse over for more information)
d5oasa2