Lineage for d5tnza2 (5tnz A:358-458)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2048292Fold b.36: PDZ domain-like [50155] (1 superfamily)
    contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix
  4. 2048293Superfamily b.36.1: PDZ domain-like [50156] (7 families) (S)
    peptide-binding domain
  5. 2048811Family b.36.1.0: automated matches [191362] (1 protein)
    not a true family
  6. 2048812Protein automated matches [190436] (8 species)
    not a true protein
  7. 2048826Species Human (Homo sapiens) [TaxId:9606] [187333] (97 PDB entries)
  8. 2297354Domain d5tnza2: 5tnz A:358-458 [340655]
    Other proteins in same PDB: d5tnza1, d5tnza3
    automated match to d1lcya1
    complexed with mes, na; mutant

Details for d5tnza2

PDB Entry: 5tnz (more details), 1.75 Å

PDB Description: htra2 s142d mutant
PDB Compounds: (A:) Serine protease HTRA2, mitochondrial

SCOPe Domain Sequences for d5tnza2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5tnza2 b.36.1.0 (A:358-458) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qrryigvmmltlspsilaelqlrepsfpdvqhgvlihkvilgspahraglrpgdvilaig
eqmvqnaedvyeavrtqsqlavqirrgretltlyvtpevte

SCOPe Domain Coordinates for d5tnza2:

Click to download the PDB-style file with coordinates for d5tnza2.
(The format of our PDB-style files is described here.)

Timeline for d5tnza2:

  • d5tnza2 appears in periodic updates to SCOPe 2.06 starting on 2017-10-29