Lineage for d5nfzd2 (5nfz D:246-441)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2180205Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
    core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
  4. 2180489Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (2 families) (S)
  5. 2180490Family d.79.2.1: Tubulin, C-terminal domain [55308] (4 protein domains)
  6. 2180597Protein automated matches [227071] (5 species)
    not a true protein
  7. 2180601Species Cow (Bos taurus) [TaxId:9913] [226565] (43 PDB entries)
  8. 2297344Domain d5nfzd2: 5nfz D:246-441 [340645]
    Other proteins in same PDB: d5nfza1, d5nfzb1, d5nfzc1, d5nfzd1, d5nfze_, d5nfzf1, d5nfzf2, d5nfzf3
    automated match to d3rycd2
    complexed with 8wb, acp, ca, gdp, gol, gtp, mes, mg

Details for d5nfzd2

PDB Entry: 5nfz (more details), 2.1 Å

PDB Description: tubulin-mtc complex
PDB Compounds: (D:) Tubulin beta-2B chain

SCOPe Domain Sequences for d5nfzd2:

Sequence, based on SEQRES records: (download)

>d5nfzd2 d.79.2.1 (D:246-441) automated matches {Cow (Bos taurus) [TaxId: 9913]}
gqlnadlrklavnmvpfprlhffmpgfapltsrgsqqyraltvpeltqqmfdsknmmaac
dprhgryltvaaifrgrmsmkevdeqmlnvqnknssyfvewipnnvktavcdipprglkm
satfignstaiqelfkriseqftamfrrkaflhwytgegmdemefteaesnmndlvseyq
qyqdatad

Sequence, based on observed residues (ATOM records): (download)

>d5nfzd2 d.79.2.1 (D:246-441) automated matches {Cow (Bos taurus) [TaxId: 9913]}
gqlnadlrklavnmvpfprlhffmpgfapltsrgsqltvpeltqqmfdsknmmaacdprh
gryltvaaifrgrmsmkevdeqmlnvqnknssyfvewipnnvktavcdipprglkmsatf
ignstaiqelfkriseqftamfrrkaflhwytgegmdemefteaesnmndlvseyqqyqd
atad

SCOPe Domain Coordinates for d5nfzd2:

Click to download the PDB-style file with coordinates for d5nfzd2.
(The format of our PDB-style files is described here.)

Timeline for d5nfzd2:

  • d5nfzd2 appears in periodic updates to SCOPe 2.06 starting on 2017-10-29