Lineage for d5vbma1 (5vbm A:1-169)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2109203Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2109204Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2110099Family c.37.1.8: G proteins [52592] (79 protein domains)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 2111131Protein automated matches [190047] (28 species)
    not a true protein
  7. 2111209Species Human (Homo sapiens) [TaxId:9606] [186768] (168 PDB entries)
  8. 2297341Domain d5vbma1: 5vbm A:1-169 [340642]
    Other proteins in same PDB: d5vbma2
    automated match to d4lyhb_
    complexed with 92v, gdp, mg

Details for d5vbma1

PDB Entry: 5vbm (more details), 1.49 Å

PDB Description: crystal structure of small molecule disulfide 2c07 bound to k-ras cys light m72c gdp
PDB Compounds: (A:) GTPase KRas

SCOPe Domain Sequences for d5vbma1:

Sequence, based on SEQRES records: (download)

>d5vbma1 c.37.1.8 (A:1-169) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mteyklvvvgaggvgksaltiqliqnhfvdeydptiedsyrkqvvidgetslldildtag
qeeysamrdqycrtgegfllvfainntksfedihhyreqikrvkdsedvpmvlvgnksdl
psrtvdtkqaqdlarsygipfietsaktrqgvddafytlvreirkhkek

Sequence, based on observed residues (ATOM records): (download)

>d5vbma1 c.37.1.8 (A:1-169) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mteyklvvvgaggvgksaltiqliqnhfvdeydptiedsyrkqvvidgetslldildtag
eysamrdqycrtgegfllvfainntksfedihhyreqikrvkdsedvpmvlvgnksdlps
rtvdtkqaqdlarsygipfietsaktrqgvddafytlvreirkhkek

SCOPe Domain Coordinates for d5vbma1:

Click to download the PDB-style file with coordinates for d5vbma1.
(The format of our PDB-style files is described here.)

Timeline for d5vbma1:

  • d5vbma1 appears in periodic updates to SCOPe 2.06 starting on 2017-10-29

View in 3D
Domains from same chain:
(mouse over for more information)
d5vbma2