Lineage for d5uqxb_ (5uqx B:)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2154577Fold d.3: Cysteine proteinases [54000] (1 superfamily)
    consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn
  4. 2154578Superfamily d.3.1: Cysteine proteinases [54001] (24 families) (S)
    the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet
  5. 2155259Family d.3.1.9: Ubiquitin carboxyl-terminal hydrolase, UCH [82568] (6 protein domains)
    Pfam PF00443
  6. 2155284Protein automated matches [191167] (1 species)
    not a true protein
  7. 2155285Species Human (Homo sapiens) [TaxId:9606] [189384] (14 PDB entries)
  8. 2297334Domain d5uqxb_: 5uqx B: [340635]
    automated match to d1nb8b_
    complexed with 8jp

Details for d5uqxb_

PDB Entry: 5uqx (more details), 2.23 Å

PDB Description: usp7 in complex with gne6776 (6'-amino-4'-ethyl-5'-(4-hydroxyphenyl)- n-methyl-[3,3'-bipyridine]-6-carboxamide)
PDB Compounds: (B:) Ubiquitin carboxyl-terminal hydrolase 7

SCOPe Domain Sequences for d5uqxb_:

Sequence, based on SEQRES records: (download)

>d5uqxb_ d.3.1.9 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
kkhtgyvglknqgatcymnsllqtlfftnqlrkavymmptegddssksvplalqrvfyel
qhsdkpvgtkkltksfgwetldsfmqhdvqelcrvlldnvenkmkgtcvegtipklfrgk
mvsyiqckevdyrsdrredyydiqlsikgkknifesfvdyvaveqldgdnkydagehglq
eaekgvkfltlppvlhlqlmrfmydpqtdqnikindrfefpeqlpldeflqktdpkdpan
yilhavlvhsgdnhgghyvvylnpkgdgkwckfdddvvsrctkeeaiehnygghdddlsv
rhctnaymlvyiresklsevlqavtdhdipqqlverlqeekrieaqkr

Sequence, based on observed residues (ATOM records): (download)

>d5uqxb_ d.3.1.9 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
kkhtgyvglknqgatcymnsllqtlfftnqlrkavymmptegddssksvplalqrvfyel
qhsdkpvgtkkltksfgwetldsfmqhdvqelcrvlldnvenkmkgtcvegtipklfrgk
mvsyiqckevdyrsdrredyydiqlsikgkknifesfvdyvaveqldgdnkydagehglq
eaekgvkfltlppvlhlqlmrfmikindrfefpeqlpldeflqktdpkdpanyilhavlv
hsgdnhgghyvvylnpkgdgkwckfdddvvsrctkeeaiehnygghctnaymlvyiresk
lsevlqavtdhdipqqlverlqeekrieaqkr

SCOPe Domain Coordinates for d5uqxb_:

Click to download the PDB-style file with coordinates for d5uqxb_.
(The format of our PDB-style files is described here.)

Timeline for d5uqxb_:

  • d5uqxb_ appears in periodic updates to SCOPe 2.06 starting on 2017-10-29