SCOPe 2.06: Domain d5tpsa1: 5tps A:238-339

Lineage for d5tpsa1 (5tps A:238-339)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein Immunoglobulin heavy chain gamma constant domain 2, CH2-gamma [88584] (4 species)

7. Species Human (Homo sapiens) [TaxId:9606] [88585] (57 PDB entries)
   Uniprot P01857 #118-327 ! Uniprot P01857 118-327 # GC1_HUMAN Ig gamma-1 chain C region

8. Domain d5tpsa1: 5tps A:238-339 [340617]
   Other proteins in same PDB: d5tpsa2, d5tpsb2
   automated match to d1hzhh3
   complexed with bma, fuc, gal, man, nag

Details for d5tpsa1

PDB Entry: 5tps, 2.7 Å

PDB Description: structure of a fc heterodimer

PDB Compounds: (A:) Ig gamma-1 chain C region

SCOPe Domain Sequences for d5tpsa1:

Sequence; same for both SEQRES and ATOM records:

>d5tpsa1 b.1.1.2 (A:238-339) Immunoglobulin heavy chain gamma constant domain 2, CH2-gamma {Human (Homo sapiens) [TaxId: 9606]}
psvflfppkpkdtlmisrtpevtcvvvdvshedpevkfnwyvdgvevhnaktkpreeqyn
styrvvsvltvlhqdwlngkeykckvsnkalpapiektiska

Timeline for d5tpsa1:

• d5tpsa1 is new in SCOPe 2.06-stable
  
• d5tpsa1 appears in SCOPe 2.07
  
• d5tpsa1 appears in the current release, SCOPe 2.08