Class g: Small proteins [56992] (94 folds) |
Fold g.97: Iron-sulfur cluster-binding zinc finger CDGSH type [310565] (1 superfamily) Fe-S binding region and beta cap |
Superfamily g.97.1: Iron-sulfur cluster-binding zinc finger CDGSH type [310593] (2 families) Pfam PF09360; PubMed 17766440 |
Family g.97.1.1: Outer mitochondrial membrane protein mitoNEET-like [310640] (2 proteins) |
Protein automated matches [310858] (1 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [311238] (12 PDB entries) |
Domain d2r13a1: 2r13 A:33-105 [340606] Other proteins in same PDB: d2r13a2 automated match to d3lpqa_ complexed with cl, fes |
PDB Entry: 2r13 (more details), 1.8 Å
SCOPe Domain Sequences for d2r13a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2r13a1 g.97.1.1 (A:33-105) automated matches {Human (Homo sapiens) [TaxId: 9606]} rfyvkdhrnkaminlhiqkdnpkivhafdmedlgdkavycrcwrskkfpfcdgahtkhne etgdnvgpliikk
Timeline for d2r13a1: