Lineage for d5oq7b_ (5oq7 B:)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2195565Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2195566Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2195690Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 protein domains)
    members organized in the groups and subfamiles specified by the comments
  6. 2198144Protein automated matches [190091] (16 species)
    not a true protein
  7. 2198237Species Human (Homo sapiens) [TaxId:9606] [188447] (646 PDB entries)
  8. 2297303Domain d5oq7b_: 5oq7 B: [340604]
    automated match to d2ydia_
    complexed with a0q; mutant

Details for d5oq7b_

PDB Entry: 5oq7 (more details), 2.1 Å

PDB Description: structure of chk1 8-pt. mutant complex with arylbenzamide lrrk2 inhibitor
PDB Compounds: (B:) Serine/threonine-protein kinase Chk1

SCOPe Domain Sequences for d5oq7b_:

Sequence, based on SEQRES records: (download)

>d5oq7b_ d.144.1.7 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dwdlvqtlgegaygevqlavnrvteeavavkivdmkravdcpenikkeicilkmlnhenv
ikfyghrregniqylfmelasggslfdriepdigmpepdaqrffhqlmagvvylhgigit
hrdikphnlllderdnlkiadfglatvfrynnrerllnkmcgtlpyvapellkrrefhae
pvdvwscgivltamlagelpwdqpsdscqeysdwkekktylnpwkkidsaplallhkilv
enpsaritipdikkdrwynkplk

Sequence, based on observed residues (ATOM records): (download)

>d5oq7b_ d.144.1.7 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dwdlvqtlgeggevqlavnrvteeavavkivdmcpenikkeicilkmlnhenvikfyghr
regniqylfmelasggslfdriepdigmpepdaqrffhqlmagvvylhgigithrdikph
nlllderdnlkiadfglatvfrynnrerllnkmcgtlpyvapellkrrefhaepvdvwsc
givltamlagelpwdqpsdscqeysdwkekktylnpwkkidsaplallhkilvenpsari
tipdikkdrwynkplk

SCOPe Domain Coordinates for d5oq7b_:

Click to download the PDB-style file with coordinates for d5oq7b_.
(The format of our PDB-style files is described here.)

Timeline for d5oq7b_:

  • d5oq7b_ appears in periodic updates to SCOPe 2.06 starting on 2017-10-29