![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
![]() | Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) ![]() |
![]() | Family c.1.8.0: automated matches [191314] (1 protein) not a true family |
![]() | Protein automated matches [190075] (93 species) not a true protein |
![]() | Species Geobacillus stearothermophilus [TaxId:1422] [319127] (16 PDB entries) |
![]() | Domain d5okjb_: 5okj B: [340599] automated match to d1pbga_ complexed with gol, imd, trs |
PDB Entry: 5okj (more details), 1.76 Å
SCOPe Domain Sequences for d5okjb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5okjb_ c.1.8.0 (B:) automated matches {Geobacillus stearothermophilus [TaxId: 1422]} hlkpfppeflwgaasaayqvegawnedgkglsvwdvfakqpgrtfkgtngdvavdhyhry qedvalmaemglkayrfsvswsrvfpdgngavnekgldfydrlieelrnhgiepivtlyh wdvpqalmdaygawesrriiddfdryavtlfqrfgdrvkywvtlneqnifisfgyrlglh ppgvkdmkrmyeanhianlanakviqsfrhyvpdgkigpsfayspmypydsrpenvlafe naeefqnhwwmdvyawgmypqaawnylesqgleptvapgdwellqaakpdfmgvnyyqtt tvehnppdgvgegvmnttgkkgtstssgipglfktvrnphvdttnwdwaidpvglriglr rianryqlpilitenglgefdtlepgdivnddyridylrrhvqeiqraitdgvdvlgyca wsftdllswlngyqkrygfvyvnrddesekdlrrikkksfywyqrvietngael
Timeline for d5okjb_: