Lineage for d5okjb_ (5okj B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2081496Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2083716Family c.1.8.0: automated matches [191314] (1 protein)
    not a true family
  6. 2083717Protein automated matches [190075] (89 species)
    not a true protein
  7. 2275826Species Geobacillus stearothermophilus [TaxId:1422] [319127] (17 PDB entries)
  8. 2297298Domain d5okjb_: 5okj B: [340599]
    automated match to d1pbga_
    complexed with gol, imd, trs

Details for d5okjb_

PDB Entry: 5okj (more details), 1.76 Å

PDB Description: non-conservatively refined structure of gan1d-wt, a putative 6- phospho-beta-galactosidase from geobacillus stearothermophilus, in the c2 spacegroup
PDB Compounds: (B:) Putative 6-phospho-beta-galactobiosidase

SCOPe Domain Sequences for d5okjb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5okjb_ c.1.8.0 (B:) automated matches {Geobacillus stearothermophilus [TaxId: 1422]}
hlkpfppeflwgaasaayqvegawnedgkglsvwdvfakqpgrtfkgtngdvavdhyhry
qedvalmaemglkayrfsvswsrvfpdgngavnekgldfydrlieelrnhgiepivtlyh
wdvpqalmdaygawesrriiddfdryavtlfqrfgdrvkywvtlneqnifisfgyrlglh
ppgvkdmkrmyeanhianlanakviqsfrhyvpdgkigpsfayspmypydsrpenvlafe
naeefqnhwwmdvyawgmypqaawnylesqgleptvapgdwellqaakpdfmgvnyyqtt
tvehnppdgvgegvmnttgkkgtstssgipglfktvrnphvdttnwdwaidpvglriglr
rianryqlpilitenglgefdtlepgdivnddyridylrrhvqeiqraitdgvdvlgyca
wsftdllswlngyqkrygfvyvnrddesekdlrrikkksfywyqrvietngael

SCOPe Domain Coordinates for d5okjb_:

Click to download the PDB-style file with coordinates for d5okjb_.
(The format of our PDB-style files is described here.)

Timeline for d5okjb_:

  • d5okjb_ appears in periodic updates to SCOPe 2.06 starting on 2017-10-29