Lineage for d5iuua_ (5iuu A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2140671Fold c.82: ALDH-like [53719] (1 superfamily)
    consists of two similar domains with 3 layers (a/b/a) each; duplication
    core: parallel beta-sheet of 5 strands, order 32145
  4. 2140672Superfamily c.82.1: ALDH-like [53720] (3 families) (S)
    binds NAD differently from other NAD(P)-dependent oxidoreductases
  5. 2141090Family c.82.1.0: automated matches [191448] (1 protein)
    not a true family
  6. 2141091Protein automated matches [190683] (49 species)
    not a true protein
  7. 2297147Species Pseudomonas syringae [TaxId:223283] [340448] (3 PDB entries)
  8. 2297289Domain d5iuua_: 5iuu A: [340590]
    automated match to d4lihb_

Details for d5iuua_

PDB Entry: 5iuu (more details), 2.09 Å

PDB Description: crystal structure of indole-3-acetaldehyde dehydrogenase in apo form
PDB Compounds: (A:) Aldehyde dehydrogenase family protein

SCOPe Domain Sequences for d5iuua_:

Sequence, based on SEQRES records: (download)

>d5iuua_ c.82.1.0 (A:) automated matches {Pseudomonas syringae [TaxId: 223283]}
tltradweqraqnlkiegrafiqgeytaaasgetfdcispvdgrllakvascdaadaqra
vesarsafdsgawsrlapakrkatmirfaglleqnaeelalletldmgkpisdslgvdip
ggaralswsgeaidklydevaatphdqlglvtrepvgvvaaivpwnfplmmacwklgpal
stgnsvvlkpsekspltairiaqlaieagipagvlnvlpgyghtvgkalalhmdvdtvvf
tgstkiakqlmiyagesnmkrvwleaggkspnivfadapdlqaaadsaasaiafnqgevc
tagsrllversikdrflpmviealgtwkpgnpldpatnvgalvdtqqmntvlsyiaaght
dgarlvaggkqilqetggtyveptifdgvnnamriaqeeifgpvlsvltfdtaeeaiqia
ndtpyglaaavwtanlskahltaralragsvwvnqydggdmtapfggfkqsgngrdkslh
afdkytelkstwikl

Sequence, based on observed residues (ATOM records): (download)

>d5iuua_ c.82.1.0 (A:) automated matches {Pseudomonas syringae [TaxId: 223283]}
tltradweqraqnlkiegrafiqgeytaaasgetfdcispvdgrllakvascdaadaqra
vesarsafdsgawsrlapakrkatmirfaglleqnaeelalletldmgkpisdslgvdip
ggaralswsgeaidklydevaatphdqlglvtrepvgvvaaivpwnfplmmacwklgpal
stgnsvvlkpsekspltairiaqlaieagipagvlnvlpgyghtvgkalalhmdvdtvvf
tgstkiakqlmiyagesnmkrvwleaggkspnivfadapdlqaaadsaasaiafsrllve
rsikdrflpmviealgtwkpgnpldpatnvgalvdtaqeeifgpvlsvltfdtaeeaiqi
andtpyglaaavwtanlskahltaralragsvwvnqydggdmtapfggfkqsgngrdksl
hafdkytelkstwikl

SCOPe Domain Coordinates for d5iuua_:

Click to download the PDB-style file with coordinates for d5iuua_.
(The format of our PDB-style files is described here.)

Timeline for d5iuua_:

  • d5iuua_ appears in periodic updates to SCOPe 2.06 starting on 2017-10-29

View in 3D
Domains from other chains:
(mouse over for more information)
d5iuub_