Lineage for d5o84a1 (5o84 A:3-83)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2116932Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2116933Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2118983Family c.47.1.0: automated matches [191312] (1 protein)
    not a true family
  6. 2118984Protein automated matches [190056] (165 species)
    not a true protein
  7. 2120090Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [196344] (16 PDB entries)
  8. 2297278Domain d5o84a1: 5o84 A:3-83 [340579]
    Other proteins in same PDB: d5o84a2
    automated match to d4chsa1
    complexed with act, edo, fmt, gol, mg

Details for d5o84a1

PDB Entry: 5o84 (more details), 1.88 Å

PDB Description: glutathione s-transferase tau 23 (partially oxidized)
PDB Compounds: (A:) Glutathione S-transferase U23

SCOPe Domain Sequences for d5o84a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5o84a1 c.47.1.0 (A:3-83) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
eeiilldywasmygmrtrialeekkvkyeyreedlsnksplllqmnpihkkipvlihegk
picesiiqvqyidelwpdtnp

SCOPe Domain Coordinates for d5o84a1:

Click to download the PDB-style file with coordinates for d5o84a1.
(The format of our PDB-style files is described here.)

Timeline for d5o84a1:

  • d5o84a1 appears in periodic updates to SCOPe 2.06 starting on 2017-10-29

View in 3D
Domains from same chain:
(mouse over for more information)
d5o84a2