Lineage for d5owua_ (5owu A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2006336Fold a.118: alpha-alpha superhelix [48370] (25 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2006337Superfamily a.118.1: ARM repeat [48371] (26 families) (S)
  5. 2006338Family a.118.1.1: Armadillo repeat [48372] (7 protein domains)
  6. 2006450Protein automated matches [190070] (4 species)
    not a true protein
  7. 2283825Species Saccharomyces cerevisiae [TaxId:559292] [327126] (3 PDB entries)
  8. 2297268Domain d5owua_: 5owu A: [340569]
    automated match to d3nd2a_

Details for d5owua_

PDB Entry: 5owu (more details), 2 Å

PDB Description: kap95:nup1 complex
PDB Compounds: (A:) Importin subunit beta-1

SCOPe Domain Sequences for d5owua_:

Sequence, based on SEQRES records: (download)

>d5owua_ a.118.1.1 (A:) automated matches {Saccharomyces cerevisiae [TaxId: 559292]}
mstaefaqllensilspdqnirltsetqlkklsndnflqfaglssqvlidentklegril
aaltlknelvskdsvktqqfaqrwitqvspeaknqiktnaltalvsieprianaaaqlia
aiadielphgawpelmkimvdntgaeqpenvkrasllalgymcesadpqsqalvsssnni
liaivqgaqstetskavrlaalnaladslifiknnmeregernylmqvvceatqaediev
qaaafgclckimslyytfmkpymeqalyaltiatmkspndkvasmtvefwsticeeeidi
ayelaqfpqsplqsynfalssikdvvpnllnlltrqnedpedddwnvsmsagaclqlfaq
ncgnhilepvlefveqnitadnwrnreaavmafgsimdgpdkvqrtyyvhqalpsilnlm
ndqslqvkettawcigriadsvaesidpqqhlpgvvqacliglqdhpkvatncswtiinl
veqlaeatpspiynfypalvdgligaanridnefnarasafsalttmveyatdtvaetsa
sistfvmdklgqtmsvdenqltledaqslqelqsniltvlaavirkspssvepvadmlmg
lffrllekkdsafieddvfyaisalaaslgkgfekyletfspyllkalnqvdspvsitav
gfiadisnsleedfrrysdammnvlaqmisnpnarrelkpavlsvfgdiasnigadfipy
lndimalcvaaqntkpengtlealdyqikvleavldayvgivaglhdkpealfpyvgtif
qfiaqvaedpqlysedatsraavgligdiaamfpdgsikqfygqdwvidyikrtrsgqlf
sqatkdtarwareqqkrqlsl

Sequence, based on observed residues (ATOM records): (download)

>d5owua_ a.118.1.1 (A:) automated matches {Saccharomyces cerevisiae [TaxId: 559292]}
mstaefaqllensilspdqnirltsetqlkklsndnflqfaglssqvlidentklegril
aaltlknelvskdsvktqqfaqrwitqvspeaknqiktnaltalvsieprianaaaqlia
aiadielphgawpelmkimvdntgaeqpenvkrasllalgymcesadpqsqalvsssnni
liaivqgaqstetskavrlaalnaladslifiknnmeregernylmqvvceatqaediev
qaaafgclckimslyytfmkpymeqalyaltiatmkspndkvasmtvefwsticeeeidi
ayelaqfpqsplqsynfalssikdvvpnllnlltrqnededddwnvsmsagaclqlfaqn
cgnhilepvlefveqnitadnwrnreaavmafgsimdgpdkvqrtyyvhqalpsilnlmn
dqslqvkettawcigriadsvaesidpqqhlpgvvqacliglqdhpkvatncswtiinlv
eqlaeatpspiynfypalvdgligaanridnefnarasafsalttmveyatdtvaetsas
istfvmdklgqtmsvdenqltledaqslqelqsniltvlaavirkspssvepvadmlmgl
ffrllekkdsafieddvfyaisalaaslgkgfekyletfspyllkalnqvdspvsitavg
fiadisnsleedfrrysdammnvlaqmisnpnarrelkpavlsvfgdiasnigadfipyl
ndimalcvaaqntkpengtlealdyqikvleavldayvgivaglhdkpealfpyvgtifq
fiaqvaedpqlysedatsraavgligdiaamfpdgsikqfygqdwvidyikrtrsgqlfs
qatkdtarwareqqkrqlsl

SCOPe Domain Coordinates for d5owua_:

Click to download the PDB-style file with coordinates for d5owua_.
(The format of our PDB-style files is described here.)

Timeline for d5owua_:

  • d5owua_ appears in periodic updates to SCOPe 2.06 starting on 2017-10-29