Lineage for d5ok9f1 (5ok9 F:1-242)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2332674Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2333633Superfamily a.118.7: 14-3-3 protein [48445] (1 family) (S)
    automatically mapped to Pfam PF00244
  5. 2333634Family a.118.7.1: 14-3-3 protein [48446] (5 proteins)
  6. 2333684Protein automated matches [190238] (9 species)
    not a true protein
  7. 2333696Species Human (Homo sapiens) [TaxId:9606] [187008] (43 PDB entries)
  8. 2333746Domain d5ok9f1: 5ok9 F:1-242 [340561]
    Other proteins in same PDB: d5ok9a2, d5ok9b2, d5ok9e2, d5ok9f2
    automated match to d4dnkb_
    complexed with peg, sep

Details for d5ok9f1

PDB Entry: 5ok9 (more details), 2.35 Å

PDB Description: ch1 chimera of human 14-3-3 sigma with the hspb6 phosphopeptide in a conformation with swapped phosphopeptides
PDB Compounds: (F:) 14-3-3 protein sigma,Heat shock protein beta-6

SCOPe Domain Sequences for d5ok9f1:

Sequence, based on SEQRES records: (download)

>d5ok9f1 a.118.7.1 (F:1-242) automated matches {Human (Homo sapiens) [TaxId: 9606]}
merasliqkaklaeqaeryedmaafmkgavekgeelsceernllsvayknvvggqraawr
vlssieqksneegsaaagpevreyrekvetelqgvcdtvlglldshlikeagdaesrvfy
lkmkgdyyrylaevatgddkkriidsarsayqeamdiskkempptnpirlglalnfsvfh
yeianspeeaislakttfdeamadlhtlsedsykdstlimqllrdnltlwtgsgslrras
ap

Sequence, based on observed residues (ATOM records): (download)

>d5ok9f1 a.118.7.1 (F:1-242) automated matches {Human (Homo sapiens) [TaxId: 9606]}
merasliqkaklaeqaeryedmaafmkgavekgeelsceernllsvayknvvggqraawr
vlssieqksnaagpevreyrekvetelqgvcdtvlglldshlikeagdaesrvfylkmkg
dyyrylaevatgddkkriidsarsayqeamdiskkempptnpirlglalnfsvfhyeian
speeaislakttfdeamadlhtlsedsykdstlimqllrdnltlwtgsgslrrasap

SCOPe Domain Coordinates for d5ok9f1:

Click to download the PDB-style file with coordinates for d5ok9f1.
(The format of our PDB-style files is described here.)

Timeline for d5ok9f1: