Lineage for d5oked_ (5oke D:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2081496Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2083716Family c.1.8.0: automated matches [191314] (1 protein)
    not a true family
  6. 2083717Protein automated matches [190075] (89 species)
    not a true protein
  7. 2275826Species Geobacillus stearothermophilus [TaxId:1422] [319127] (17 PDB entries)
  8. 2297255Domain d5oked_: 5oke D: [340556]
    automated match to d1pbga_
    complexed with bg6, gol, imd, xyt; mutant

Details for d5oked_

PDB Entry: 5oke (more details), 1.31 Å

PDB Description: conservatively refined structure of gan1d-e170q, a catalytic mutant of a putative 6-phospho-beta-galactosidase from geobacillus stearothermophilus, in complex with cellobiose-6-phosphate
PDB Compounds: (D:) Putative 6-phospho-beta-galactobiosidase

SCOPe Domain Sequences for d5oked_:

Sequence, based on SEQRES records: (download)

>d5oked_ c.1.8.0 (D:) automated matches {Geobacillus stearothermophilus [TaxId: 1422]}
hlkpfppeflwgaasaayqvegawnedgkglsvwdvfakqpgrtfkgtngdvavdhyhry
qedvalmaemglkayrfsvswsrvfpdgngavnekgldfydrlieelrnhgiepivtlyh
wdvpqalmdaygawesrriiddfdryavtlfqrfgdrvkywvtlnqqnifisfgyrlglh
ppgvkdmkrmyeanhianlanakviqsfrhyvpdgkigpsfayspmypydsrpenvlafe
naeefqnhwwmdvyawgmypqaawnylesqgleptvapgdwellqaakpdfmgvnyyqtt
tvehnppdgvgegvmnttgkkgtstssgipglfktvrnphvdttnwdwaidpvglriglr
rianryqlpilitenglgefdtlepgdivnddyridylrrhvqeiqraitdgvdvlgyca
wsftdllswlngyqkrygfvyvnrddesekdlrrikkksfywyqrvietngael

Sequence, based on observed residues (ATOM records): (download)

>d5oked_ c.1.8.0 (D:) automated matches {Geobacillus stearothermophilus [TaxId: 1422]}
hlkpfppeflwgaasaayqvegawnedgkglsvwdvfakqpgrtfkgtngdvavdhyhry
qedvalmaemglkayrfsvswsrvfpdgngavnekgldfydrlieelrnhgiepivtlyh
wdvpqalmdaygawesrriiddfdryavtlfqrfgdrvkywvtlnqqnifisfgyrlglh
ppgvkdmkrmyeanhianlanakviqsfrhyvpdgkigpsfayspmypydsrpenvlafe
naeefqnhwwmdvyawgmypqaawnylesqgleptvapgdwellqaakpdfmgvnyyqtt
tvehnppdgvgtssgipglfktvrnphvdttnwdwaidpvglriglrrianryqlpilit
englgefdtlepgdivnddyridylrrhvqeiqraitdgvdvlgycawsftdllswlngy
qkrygfvyvnrddesekdlrrikkksfywyqrvietngael

SCOPe Domain Coordinates for d5oked_:

Click to download the PDB-style file with coordinates for d5oked_.
(The format of our PDB-style files is described here.)

Timeline for d5oked_:

  • d5oked_ appears in periodic updates to SCOPe 2.06 starting on 2017-10-29