Lineage for d5gwrd_ (5gwr D:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2090218Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2090219Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2094257Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 2094258Protein automated matches [190069] (236 species)
    not a true protein
  7. 2297129Species Bacillus thuringiensis [TaxId:1428] [340430] (3 PDB entries)
  8. 2297254Domain d5gwrd_: 5gwr D: [340555]
    automated match to d4dqxb_
    complexed with edo, nad

Details for d5gwrd_

PDB Entry: 5gwr (more details), 2.2 Å

PDB Description: 4-hydroxyisoleucine dehydrogenase complexed with nadh
PDB Compounds: (D:) 4-hydroxyisolecuine dehydrogenase

SCOPe Domain Sequences for d5gwrd_:

Sequence, based on SEQRES records: (download)

>d5gwrd_ c.2.1.0 (D:) automated matches {Bacillus thuringiensis [TaxId: 1428]}
nkiimisgansgighacikyfleksfhvialdinnnnlidymktdmplkvvqidlsnsea
ihnlftqldleklspdilinaagireitpvlhlsddmfkkvidvnlvapfilsrevakrw
ceskikgcivniasvsglmaeperaayvaskhaligltkqmamefgkqnirvnsispgvi
rtelteeyfsnkalmsmiksnqsldtwglpqdivscieylisdqarfitgsnfvidggwt
agk

Sequence, based on observed residues (ATOM records): (download)

>d5gwrd_ c.2.1.0 (D:) automated matches {Bacillus thuringiensis [TaxId: 1428]}
nkiimisgansgighacikyfleksfhvialdinnnnlmplkvvqidlsnseaihnlftq
ldleklspdilinaagireitpvlhlsddmfkkvidvnlvapfilsrevakrwceskikg
civniasvsglmaeperaayvaskhaligltkqmamefgkqnirvnsispgvirtealms
miksnqsldtwglpqdivscieylisdqarfitgsnfvidggwtagk

SCOPe Domain Coordinates for d5gwrd_:

Click to download the PDB-style file with coordinates for d5gwrd_.
(The format of our PDB-style files is described here.)

Timeline for d5gwrd_:

  • d5gwrd_ appears in periodic updates to SCOPe 2.06 starting on 2017-10-29