![]() | Class b: All beta proteins [48724] (178 folds) |
![]() | Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) sandwich; 12-14 strands in 2 sheets; complex topology |
![]() | Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) ![]() |
![]() | Family b.29.1.0: automated matches [191363] (1 protein) not a true family |
![]() | Protein automated matches [190437] (54 species) not a true protein |
![]() | Species Bacteroides ovatus [TaxId:28116] [321066] (5 PDB entries) |
![]() | Domain d5nbob_: 5nbo B: [340551] automated match to d3atga_ complexed with edo |
PDB Entry: 5nbo (more details), 1.8 Å
SCOPe Domain Sequences for d5nbob_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5nbob_ b.29.1.0 (B:) automated matches {Bacteroides ovatus [TaxId: 28116]} ilfkddfnffdekvwtkethepgwtnqelqaydaahvsvgkdgdksvliltaerkgnkiy sgrinskgkksfkyrkieasiklpktngglwpafwmmgdndkqwpacgeidimemgeqsg maagdsekqvntaihygpsaaaheqqyykanvanslqdgnyhtysldwdennltisidnv kfhtfdissntyfhdnfyilfnlavggaftgitdinkltglkdgqkvnmyidwvkil
Timeline for d5nbob_: