Lineage for d5xi5a2 (5xi5 A:246-437)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2180205Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
    core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
  4. 2180489Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (2 families) (S)
  5. 2180490Family d.79.2.1: Tubulin, C-terminal domain [55308] (4 protein domains)
  6. 2180597Protein automated matches [227071] (5 species)
    not a true protein
  7. 2180710Species Sus barbatus [TaxId:41807] [278826] (6 PDB entries)
  8. 2297249Domain d5xi5a2: 5xi5 A:246-437 [340550]
    Other proteins in same PDB: d5xi5a1, d5xi5b1, d5xi5c1, d5xi5d1, d5xi5e_, d5xi5f1, d5xi5f2
    automated match to d4i50a2
    complexed with acp, ca, gdp, gtp, mes, mg, pn6

Details for d5xi5a2

PDB Entry: 5xi5 (more details), 2.81 Å

PDB Description: crystal structure of t2r-ttl-po5 complex
PDB Compounds: (A:) Tubulin alpha chain

SCOPe Domain Sequences for d5xi5a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5xi5a2 d.79.2.1 (A:246-437) automated matches {Sus barbatus [TaxId: 41807]}
galnvdltefqtnlvpyprihfplatyapvisaekayheqlsvaeitnacfepanqmvkc
dprhgkymaccllyrgdvvpkdvnaaiatiktkrsiqfvdwcptgfkvginyqpptvvpg
gdlakvqravcmlsnttaiaeawarldhkfdlmyakrafvhwyvgegmeegefsearedm
aalekdyeevgv

SCOPe Domain Coordinates for d5xi5a2:

Click to download the PDB-style file with coordinates for d5xi5a2.
(The format of our PDB-style files is described here.)

Timeline for d5xi5a2:

  • d5xi5a2 appears in periodic updates to SCOPe 2.06 starting on 2017-10-29