Lineage for d5opba_ (5opb A:)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2195565Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2195566Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2195690Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 protein domains)
    members organized in the groups and subfamiles specified by the comments
  6. 2198144Protein automated matches [190091] (16 species)
    not a true protein
  7. 2198237Species Human (Homo sapiens) [TaxId:9606] [188447] (646 PDB entries)
  8. 2297246Domain d5opba_: 5opb A: [340547]
    automated match to d2ydia_
    complexed with a1n, cl; mutant

Details for d5opba_

PDB Entry: 5opb (more details), 1.55 Å

PDB Description: structure of chk1 10-pt. mutant complex with indazole lrrk2 inhibitor
PDB Compounds: (A:) Serine/threonine-protein kinase Chk1

SCOPe Domain Sequences for d5opba_:

Sequence, based on SEQRES records: (download)

>d5opba_ d.144.1.7 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
fvedwdlvqtlgegaygevqlavnrvteeavavkivdmkravdcpenikkeicilkmlnh
envikfyghrregniqylfmelasggslfdriepdigmpepdaqrffhqlmagvvylhgi
githrdikphnlllderdnlkiadyslatvfrynnrerllnkmcgtlpyvapellkrref
haepvdvwscgivltamlagelpwdqpsdscqeysdwkekktylnpwkkidsaplallhk
ilvenpsaritipdikkdrwynkplkk

Sequence, based on observed residues (ATOM records): (download)

>d5opba_ d.144.1.7 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
fvedwdlvqtlgegaygevqlavnrvteeavavkivdmcpenikkeicilkmlnhenvik
fyghrregniqylfmelasggslfdriepdigmpepdaqrffhqlmagvvylhgigithr
dikphnlllderdnlkiadyslatvfrynnrerllnkmcgtlpyvapellkrrefhaepv
dvwscgivltamlagelpwdqpsdscqeysdwkekktylnpwkkidsaplallhkilven
psaritipdikkdrwynkplkk

SCOPe Domain Coordinates for d5opba_:

Click to download the PDB-style file with coordinates for d5opba_.
(The format of our PDB-style files is described here.)

Timeline for d5opba_:

  • d5opba_ appears in periodic updates to SCOPe 2.06 starting on 2017-10-29