Lineage for d5ng1a2 (5ng1 A:246-440)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2180205Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
    core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
  4. 2180489Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (2 families) (S)
  5. 2180490Family d.79.2.1: Tubulin, C-terminal domain [55308] (4 protein domains)
  6. 2180597Protein automated matches [227071] (5 species)
    not a true protein
  7. 2180601Species Cow (Bos taurus) [TaxId:9913] [226565] (43 PDB entries)
  8. 2297222Domain d5ng1a2: 5ng1 A:246-440 [340523]
    Other proteins in same PDB: d5ng1a1, d5ng1b1, d5ng1c1, d5ng1d1, d5ng1e_, d5ng1f1, d5ng1f2, d5ng1f3
    automated match to d4i50a2
    complexed with 8wb, 8we, acp, ca, gdp, gol, gtp, mes, mg, zpn

Details for d5ng1a2

PDB Entry: 5ng1 (more details), 2.2 Å

PDB Description: tubulin-mtc-zampanolide complex
PDB Compounds: (A:) Tubulin alpha-1B chain

SCOPe Domain Sequences for d5ng1a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ng1a2 d.79.2.1 (A:246-440) automated matches {Cow (Bos taurus) [TaxId: 9913]}
galnvdltefqtnlvpyprihfplatyapvisaekayheqlsvaeitnacfepanqmvkc
dprhgkymaccllyrgdvvpkdvnaaiatiktkrsiqfvdwcptgfkvginyqpptvvpg
gdlakvqravcmlsnttaiaeawarldhkfdlmyakrafvhwyvgegmeegefsearedm
aalekdyeevgvdsv

SCOPe Domain Coordinates for d5ng1a2:

Click to download the PDB-style file with coordinates for d5ng1a2.
(The format of our PDB-style files is described here.)

Timeline for d5ng1a2:

  • d5ng1a2 appears in periodic updates to SCOPe 2.06 starting on 2017-10-29