Lineage for d5mm3a_ (5mm3 A:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2162067Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 2162068Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 2163419Family c.94.1.0: automated matches [191309] (1 protein)
    not a true family
  6. 2163420Protein automated matches [190039] (140 species)
    not a true protein
  7. 2163883Species Methanosarcina mazei [TaxId:2209] [340472] (1 PDB entry)
  8. 2163884Domain d5mm3a_: 5mm3 A: [340519]
    automated match to d4hw8a_
    complexed with mal

Details for d5mm3a_

PDB Entry: 5mm3 (more details), 2.1 Å

PDB Description: unstructured mamc magnetite-binding protein located between two helices.
PDB Compounds: (A:) Sugar ABC transporter substrate-binding protein,Magnetosome protein MamC,Sugar ABC transporter substrate-binding protein

SCOPe Domain Sequences for d5mm3a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5mm3a_ c.94.1.0 (A:) automated matches {Methanosarcina mazei [TaxId: 2209]}
kieegklviwingdkgynglaevgkkfekdtgikvtvehpdkleekfpqvaatgdgpdii
fwahdrfggyaqsgllaeitpdkafqdklypftwdavryngkliaypiavealsliynkd
llpnppktweeipaldkelkakgksalmfnlqepyftwpliaadggyafkyengkydikd
vgvdnagakagltflvdliknkhmnadtdysiaeaafnkgetamtingpwawsnidtskv
nygvtvlptfkgqpskpfvgvlsaginaaspnkelakeflenylltdegleavnkdkplg
avalksyeeelakdpriaatmenaqkgeimpnipqmsafwyavrtavinaasgrlkekri
tnteaaidtgk

SCOPe Domain Coordinates for d5mm3a_:

Click to download the PDB-style file with coordinates for d5mm3a_.
(The format of our PDB-style files is described here.)

Timeline for d5mm3a_: