Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
Fold f.23: Single transmembrane helix [81407] (42 superfamilies) not a true fold annotated by the SCOP(e) curators as 'not a true fold' |
Superfamily f.23.9: Bacterial ba3 type cytochrome c oxidase subunit IIa [81473] (1 family) automatically mapped to Pfam PF08113 |
Family f.23.9.1: Bacterial ba3 type cytochrome c oxidase subunit IIa [81472] (2 proteins) |
Protein Bacterial ba3 type cytochrome c oxidase subunit IIa [81471] (1 species) functionally important, corresponds to the first helix of the aa3 type subunit II absent in the ba3 type subunit II |
Species Thermus thermophilus [TaxId:274] [81470] (26 PDB entries) |
Domain d3eh3c_: 3eh3 C: [340514] Other proteins in same PDB: d3eh3a_, d3eh3b1, d3eh3b2 automated match to d1xmec_ complexed with cu1, cua, has, hem |
PDB Entry: 3eh3 (more details), 3.1 Å
SCOPe Domain Sequences for d3eh3c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3eh3c_ f.23.9.1 (C:) Bacterial ba3 type cytochrome c oxidase subunit IIa {Thermus thermophilus [TaxId: 274]} eekpkgalavilvltltilvfwlgvyavffarg
Timeline for d3eh3c_: