Lineage for d3eh3c_ (3eh3 C:)

  1. Root: SCOPe 2.06
  2. 2223823Class f: Membrane and cell surface proteins and peptides [56835] (59 folds)
  3. 2226297Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
    not a true fold
  4. 2226726Superfamily f.23.9: Bacterial ba3 type cytochrome c oxidase subunit IIa [81473] (1 family) (S)
    automatically mapped to Pfam PF08113
  5. 2226727Family f.23.9.1: Bacterial ba3 type cytochrome c oxidase subunit IIa [81472] (2 protein domains)
  6. 2226728Protein Bacterial ba3 type cytochrome c oxidase subunit IIa [81471] (1 species)
    functionally important, corresponds to the first helix of the aa3 type subunit II absent in the ba3 type subunit II
  7. 2226729Species Thermus thermophilus [TaxId:274] [81470] (25 PDB entries)
  8. 2297213Domain d3eh3c_: 3eh3 C: [340514]
    automated match to d1xmec_
    complexed with cu1, cua, has, hem

Details for d3eh3c_

PDB Entry: 3eh3 (more details), 3.1 Å

PDB Description: structure of the reduced form of cytochrome ba3 oxidase from thermus thermophilus
PDB Compounds: (C:) Cytochrome c oxidase polypeptide 2A

SCOPe Domain Sequences for d3eh3c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3eh3c_ f.23.9.1 (C:) Bacterial ba3 type cytochrome c oxidase subunit IIa {Thermus thermophilus [TaxId: 274]}
eekpkgalavilvltltilvfwlgvyavffarg

SCOPe Domain Coordinates for d3eh3c_:

Click to download the PDB-style file with coordinates for d3eh3c_.
(The format of our PDB-style files is described here.)

Timeline for d3eh3c_:

  • d3eh3c_ appears in periodic updates to SCOPe 2.06 starting on 2017-10-29