Lineage for d5myra1 (5myr A:22-94)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1981563Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1981564Superfamily a.4.1: Homeodomain-like [46689] (20 families) (S)
    consists only of helices
  5. 1981994Family a.4.1.9: Tetracyclin repressor-like, N-terminal domain [46764] (35 proteins)
  6. 1982001Protein Ethr repressor [109651] (2 species)
  7. 1982002Species Mycobacterium tuberculosis [TaxId:1773] [109652] (28 PDB entries)
    Uniprot P96222 22-215
  8. 1982019Domain d5myra1: 5myr A:22-94 [340509]
    Other proteins in same PDB: d5myra2
    automated match to d1t56a1
    complexed with udy

Details for d5myra1

PDB Entry: 5myr (more details), 1.83 Å

PDB Description: structure of transcriptional regulatory repressor protein - ethr from mycobacterium tuberculosis in complex with compound gsk735816a at 1.83a resolution
PDB Compounds: (A:) HTH-type transcriptional regulator EthR

SCOPe Domain Sequences for d5myra1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5myra1 a.4.1.9 (A:22-94) Ethr repressor {Mycobacterium tuberculosis [TaxId: 1773]}
gddrelailataenlledrpladisvddlakgagisrptfyfyfpskeavlltlldrvvn
qadmalqtlaenp

SCOPe Domain Coordinates for d5myra1:

Click to download the PDB-style file with coordinates for d5myra1.
(The format of our PDB-style files is described here.)

Timeline for d5myra1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5myra2