Lineage for d3nwga1 (3nwg A:1-93)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2955934Superfamily d.58.56: CcmK-like [143414] (2 families) (S)
    contains extra C-terminal helix; forms compact hexameric 'tiles' of hexagonal shape
  5. 2956023Family d.58.56.0: automated matches [195116] (1 protein)
    not a true family
  6. 2956024Protein automated matches [195117] (13 species)
    not a true protein
  7. 2956048Species Desulfitobacterium hafniense [TaxId:272564] [340495] (1 PDB entry)
  8. 2956049Domain d3nwga1: 3nwg A:1-93 [340496]
    Other proteins in same PDB: d3nwga3
    automated match to d3n79a1
    complexed with gol

Details for d3nwga1

PDB Entry: 3nwg (more details), 2.7 Å

PDB Description: the crystal structure of a microcomparments protein from desulfitobacterium hafniense dcb
PDB Compounds: (A:) Microcompartments protein

SCOPe Domain Sequences for d3nwga1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3nwga1 d.58.56.0 (A:1-93) automated matches {Desulfitobacterium hafniense [TaxId: 272564]}
mesiglvevnsiargieaadamlkaaqvdlleakpvcpgkyivlicgdvaavqssvtagk
tmaahsvlddfilpnvhpqvltaisaatpltli

SCOPe Domain Coordinates for d3nwga1:

Click to download the PDB-style file with coordinates for d3nwga1.
(The format of our PDB-style files is described here.)

Timeline for d3nwga1: