Lineage for d5nupa_ (5nup A:)

  1. Root: SCOPe 2.06
  2. 2223823Class f: Membrane and cell surface proteins and peptides [56835] (59 folds)
  3. 2224301Fold f.4: Transmembrane beta-barrels [56924] (7 superfamilies)
    not a true fold, gathers together transmembrane barrels of different (n,S)
  4. 2224406Superfamily f.4.3: Porins [56935] (5 families) (S)
  5. 2224407Family f.4.3.1: Porin [56936] (2 protein domains)
    trimer, one subunit folds into (16,20) barrel
  6. 2224478Protein automated matches [190289] (5 species)
    not a true protein
  7. 2297192Species Klebsiella pneumoniae [TaxId:573] [340493] (1 PDB entry)
  8. 2297193Domain d5nupa_: 5nup A: [340494]
    automated match to d1osma_
    complexed with c8e, lmt

Details for d5nupa_

PDB Entry: 5nup (more details), 2.9 Å

PDB Description: structural basis for maintenance of bacterial outer membrane lipid asymmetry
PDB Compounds: (A:) ompk36

SCOPe Domain Sequences for d5nupa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5nupa_ f.4.3.1 (A:) automated matches {Klebsiella pneumoniae [TaxId: 573]}
aeiynkdgnkldlygkidglhyfsddksvdgdqtymrvgvkgetqindqltgygqweynv
qanntesssdqawtrlafaglkfgdagsfdygrnygvvydvtswtdvlpefggdtygsdn
flqsrangvatyrnsdffglvdglnfalqyqgkngsvsgegatnngrgwskqngdgfgts
ltydiwdgisagfayshskrtdeqnsvpalgrgdnaetytgglkydanniylasrytqty
natragslgfankaqnfevvaqyqfdfglrpsvaylqskgkdlergygdqdilkyvdvga
tyyfnknmstyvdykinllddnsftrnagistddvvalglvyqf

SCOPe Domain Coordinates for d5nupa_:

Click to download the PDB-style file with coordinates for d5nupa_.
(The format of our PDB-style files is described here.)

Timeline for d5nupa_:

  • d5nupa_ appears in periodic updates to SCOPe 2.06 starting on 2017-10-29