SCOPe 2.06: Domain d5lypa1: 5lyp A:93-228

Lineage for d5lypa1 (5lyp A:93-228)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.118: alpha-alpha superhelix [48370] (25 superfamilies)
   multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix

4. Superfamily a.118.8: TPR-like [48452] (9 families)

5. Family a.118.8.0: automated matches [191581] (1 protein)
   not a true family

6. Protein automated matches [191037] (12 species)
   not a true protein

7. Species Saccharomyces cerevisiae [TaxId:4932] [340488] (1 PDB entry)

8. Domain d5lypa1: 5lyp A:93-228 [340489]
   Other proteins in same PDB: d5lypa2
   automated match to d2buga1
   complexed with bo4

Details for d5lypa1

PDB Entry: 5lyp, 1.55 Å

PDB Description: crystal structure of the tpr domain of sgt2.

PDB Compounds: (A:) Small glutamine-rich tetratricopeptide repeat-containing protein 2

SCOPe Domain Sequences for d5lypa1:

Sequence; same for both SEQRES and ATOM records:

>d5lypa1 a.118.8.0 (A:93-228) automated matches {Saccharomyces cerevisiae [TaxId: 4932]}
eddaetkakaedlkmqgnkamankdyelainkyteaikvlptnaiyyanraaahsslkey
dqavkdaesaisidpsyfrgysrlgfakyaqgkpeealeaykkvldiegdnateamkrdy
esakkkveqslnlekt

Timeline for d5lypa1:

• d5lypa1 is new in SCOPe 2.06-stable
  
• d5lypa1 appears in SCOPe 2.07
  
• d5lypa1 appears in the current release, SCOPe 2.08