Lineage for d5lypa1 (5lyp A:93-228)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2006336Fold a.118: alpha-alpha superhelix [48370] (25 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2007336Superfamily a.118.8: TPR-like [48452] (9 families) (S)
  5. 2007586Family a.118.8.0: automated matches [191581] (1 protein)
    not a true family
  6. 2007587Protein automated matches [191037] (12 species)
    not a true protein
  7. 2297187Species Saccharomyces cerevisiae [TaxId:4932] [340488] (1 PDB entry)
  8. 2297188Domain d5lypa1: 5lyp A:93-228 [340489]
    Other proteins in same PDB: d5lypa2
    automated match to d2buga1
    complexed with bo4

Details for d5lypa1

PDB Entry: 5lyp (more details), 1.55 Å

PDB Description: crystal structure of the tpr domain of sgt2.
PDB Compounds: (A:) Small glutamine-rich tetratricopeptide repeat-containing protein 2

SCOPe Domain Sequences for d5lypa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5lypa1 a.118.8.0 (A:93-228) automated matches {Saccharomyces cerevisiae [TaxId: 4932]}
eddaetkakaedlkmqgnkamankdyelainkyteaikvlptnaiyyanraaahsslkey
dqavkdaesaisidpsyfrgysrlgfakyaqgkpeealeaykkvldiegdnateamkrdy
esakkkveqslnlekt

SCOPe Domain Coordinates for d5lypa1:

Click to download the PDB-style file with coordinates for d5lypa1.
(The format of our PDB-style files is described here.)

Timeline for d5lypa1:

  • d5lypa1 appears in periodic updates to SCOPe 2.06 starting on 2017-10-29

View in 3D
Domains from same chain:
(mouse over for more information)
d5lypa2