Lineage for d5mxva2 (5mxv A:95-214)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2008141Fold a.121: Tetracyclin repressor-like, C-terminal domain [48497] (1 superfamily)
    multihelical; interlocked (homo)dimer
  4. 2008142Superfamily a.121.1: Tetracyclin repressor-like, C-terminal domain [48498] (2 families) (S)
  5. 2008143Family a.121.1.1: Tetracyclin repressor-like, C-terminal domain [48499] (35 protein domains)
  6. 2008150Protein Ethr repressor [109978] (2 species)
  7. 2008151Species Mycobacterium tuberculosis [TaxId:1773] [109979] (30 PDB entries)
    Uniprot P96222 22-215
  8. 2297184Domain d5mxva2: 5mxv A:95-214 [340485]
    Other proteins in same PDB: d5mxva1
    automated match to d3q0wa2
    complexed with k3t

Details for d5mxva2

PDB Entry: 5mxv (more details), 1.63 Å

PDB Description: structure of transcriptional regulatory repressor protein - ethr from mycobacterium tuberculosis in complex with compound gsk1107112a at 1.63a resolution
PDB Compounds: (A:) HTH-type transcriptional regulator EthR

SCOPe Domain Sequences for d5mxva2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5mxva2 a.121.1.1 (A:95-214) Ethr repressor {Mycobacterium tuberculosis [TaxId: 1773]}
adtdrenmwrtginvffetfgshkavtragqaaratsvevaelwstfmqkwiaytaavid
aerdrgaaprtlpahelatalnlmnertlfasfageqpsvpearvldtlvhiwvtsiyge

SCOPe Domain Coordinates for d5mxva2:

Click to download the PDB-style file with coordinates for d5mxva2.
(The format of our PDB-style files is described here.)

Timeline for d5mxva2:

  • d5mxva2 appears in periodic updates to SCOPe 2.06 starting on 2017-10-29

View in 3D
Domains from same chain:
(mouse over for more information)
d5mxva1