Class a: All alpha proteins [46456] (289 folds) |
Fold a.121: Tetracyclin repressor-like, C-terminal domain [48497] (1 superfamily) multihelical; interlocked (homo)dimer |
Superfamily a.121.1: Tetracyclin repressor-like, C-terminal domain [48498] (2 families) |
Family a.121.1.1: Tetracyclin repressor-like, C-terminal domain [48499] (35 proteins) |
Protein Ethr repressor [109978] (2 species) |
Species Mycobacterium tuberculosis [TaxId:1773] [109979] (34 PDB entries) Uniprot P96222 22-215 |
Domain d5mymb2: 5mym B:95-214 [340483] Other proteins in same PDB: d5myma1, d5mymb1, d5mymc1, d5mymd1 automated match to d3q0wa2 complexed with edo, hyv |
PDB Entry: 5mym (more details), 2.28 Å
SCOPe Domain Sequences for d5mymb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5mymb2 a.121.1.1 (B:95-214) Ethr repressor {Mycobacterium tuberculosis [TaxId: 1773]} adtdrenmwrtginvffetfgshkavtragqaaratsvevaelwstfmqkwiaytaavid aerdrgaaprtlpahelatalnlmnertlfasfageqpsvpearvldtlvhiwvtsiyge
Timeline for d5mymb2: