Lineage for d5mymb2 (5mym B:95-214)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2011555Fold a.121: Tetracyclin repressor-like, C-terminal domain [48497] (1 superfamily)
    multihelical; interlocked (homo)dimer
  4. 2011556Superfamily a.121.1: Tetracyclin repressor-like, C-terminal domain [48498] (2 families) (S)
  5. 2011557Family a.121.1.1: Tetracyclin repressor-like, C-terminal domain [48499] (35 proteins)
  6. 2011564Protein Ethr repressor [109978] (2 species)
  7. 2011565Species Mycobacterium tuberculosis [TaxId:1773] [109979] (34 PDB entries)
    Uniprot P96222 22-215
  8. 2011600Domain d5mymb2: 5mym B:95-214 [340483]
    Other proteins in same PDB: d5myma1, d5mymb1, d5mymc1, d5mymd1
    automated match to d3q0wa2
    complexed with edo, hyv

Details for d5mymb2

PDB Entry: 5mym (more details), 2.28 Å

PDB Description: structure of transcriptional regulatory repressor protein - ethr from mycobacterium tuberculosis in complex with compound gsk2032710a at 2.28a resolution
PDB Compounds: (B:) HTH-type transcriptional regulator EthR

SCOPe Domain Sequences for d5mymb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5mymb2 a.121.1.1 (B:95-214) Ethr repressor {Mycobacterium tuberculosis [TaxId: 1773]}
adtdrenmwrtginvffetfgshkavtragqaaratsvevaelwstfmqkwiaytaavid
aerdrgaaprtlpahelatalnlmnertlfasfageqpsvpearvldtlvhiwvtsiyge

SCOPe Domain Coordinates for d5mymb2:

Click to download the PDB-style file with coordinates for d5mymb2.
(The format of our PDB-style files is described here.)

Timeline for d5mymb2: