Lineage for d5lvtb_ (5lvt B:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2323932Fold a.55: IHF-like DNA-binding proteins [47728] (1 superfamily)
    core: 4 helices; bundle, partly opened, capped with a beta-sheet
  4. 2323933Superfamily a.55.1: IHF-like DNA-binding proteins [47729] (3 families) (S)
    dimer of identical subunits
  5. 2323998Family a.55.1.0: automated matches [191573] (1 protein)
    not a true family
  6. 2323999Protein automated matches [191007] (9 species)
    not a true protein
  7. 2324003Species Lactococcus lactis [TaxId:272623] [340465] (1 PDB entry)
  8. 2324005Domain d5lvtb_: 5lvt B: [340478]
    automated match to d5fbmb_
    complexed with act, so4

Details for d5lvtb_

PDB Entry: 5lvt (more details), 2.1 Å

PDB Description: structure of hu protein from lactococcus lactis
PDB Compounds: (B:) DNA-binding protein HU

SCOPe Domain Sequences for d5lvtb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5lvtb_ a.55.1.0 (B:) automated matches {Lactococcus lactis [TaxId: 272623]}
mankqdliaevaaktgltkkdsekavnafgevvteflakgekvqligfgtfetreraare
grnpqtgeaikiaatvvpafkagkalkdavk

SCOPe Domain Coordinates for d5lvtb_:

Click to download the PDB-style file with coordinates for d5lvtb_.
(The format of our PDB-style files is described here.)

Timeline for d5lvtb_: