Lineage for d5nfhb2 (5nfh B:607-767)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1993200Fold a.27: Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases [47322] (1 superfamily)
    core: 4 helices; bundle; one loop crosses over one side of the bundle
  4. 1993201Superfamily a.27.1: Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases [47323] (2 families) (S)
  5. 1993254Family a.27.1.0: automated matches [227164] (1 protein)
    not a true family
  6. 1993255Protein automated matches [226872] (8 species)
    not a true protein
  7. 1993276Species Trypanosoma brucei [TaxId:999953] [226468] (27 PDB entries)
  8. 1993329Domain d5nfhb2: 5nfh B:607-767 [340475]
    Other proteins in same PDB: d5nfha1, d5nfhb1, d5nfhb3
    automated match to d4eg8b2
    protein/RNA complex; complexed with 8w2, dms, gol, met

Details for d5nfhb2

PDB Entry: 5nfh (more details), 2.8 Å

PDB Description: trypanosoma brucei methionyl-trna synthetase in complex with a quinazolinone inhibitor
PDB Compounds: (B:) Methionyl-tRNA synthetase, putative

SCOPe Domain Sequences for d5nfhb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5nfhb2 a.27.1.0 (B:607-767) automated matches {Trypanosoma brucei [TaxId: 999953]}
adtlgnlvmrctsakinvngewpspaayteedesliqlikdlpgtadhyylipdiqkaii
avfdvlrainayvtdmapwklvktdperlrtvlyitlegvrvttlllspilprksvvifd
mlgvpevhrkgienfefgavppgtrlgpavegevlfskrst

SCOPe Domain Coordinates for d5nfhb2:

Click to download the PDB-style file with coordinates for d5nfhb2.
(The format of our PDB-style files is described here.)

Timeline for d5nfhb2: