Class a: All alpha proteins [46456] (290 folds) |
Fold a.55: IHF-like DNA-binding proteins [47728] (1 superfamily) core: 4 helices; bundle, partly opened, capped with a beta-sheet |
Superfamily a.55.1: IHF-like DNA-binding proteins [47729] (3 families) dimer of identical subunits |
Family a.55.1.0: automated matches [191573] (1 protein) not a true family |
Protein automated matches [191007] (11 species) not a true protein |
Species Lactococcus lactis [TaxId:272623] [340465] (1 PDB entry) |
Domain d5lvtd_: 5lvt D: [340471] automated match to d5fbmb_ complexed with act, so4 |
PDB Entry: 5lvt (more details), 2.1 Å
SCOPe Domain Sequences for d5lvtd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5lvtd_ a.55.1.0 (D:) automated matches {Lactococcus lactis [TaxId: 272623]} mankqdliaevaaktgltkkdsekavnafgevvteflakgekvqligfgtfetreraare grnpqtgeaikiaatvvpafkagkalkdavk
Timeline for d5lvtd_: