Lineage for d5lvtd_ (5lvt D:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2715141Fold a.55: IHF-like DNA-binding proteins [47728] (1 superfamily)
    core: 4 helices; bundle, partly opened, capped with a beta-sheet
  4. 2715142Superfamily a.55.1: IHF-like DNA-binding proteins [47729] (3 families) (S)
    dimer of identical subunits
  5. 2715207Family a.55.1.0: automated matches [191573] (1 protein)
    not a true family
  6. 2715208Protein automated matches [191007] (11 species)
    not a true protein
  7. 2715217Species Lactococcus lactis [TaxId:272623] [340465] (1 PDB entry)
  8. 2715221Domain d5lvtd_: 5lvt D: [340471]
    automated match to d5fbmb_
    complexed with act, so4

Details for d5lvtd_

PDB Entry: 5lvt (more details), 2.1 Å

PDB Description: structure of hu protein from lactococcus lactis
PDB Compounds: (D:) DNA-binding protein HU

SCOPe Domain Sequences for d5lvtd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5lvtd_ a.55.1.0 (D:) automated matches {Lactococcus lactis [TaxId: 272623]}
mankqdliaevaaktgltkkdsekavnafgevvteflakgekvqligfgtfetreraare
grnpqtgeaikiaatvvpafkagkalkdavk

SCOPe Domain Coordinates for d5lvtd_:

Click to download the PDB-style file with coordinates for d5lvtd_.
(The format of our PDB-style files is described here.)

Timeline for d5lvtd_: