Lineage for d5m3na2 (5m3n A:358-458)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2379659Fold b.36: PDZ domain-like [50155] (1 superfamily)
    contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix
  4. 2379660Superfamily b.36.1: PDZ domain-like [50156] (7 families) (S)
    peptide-binding domain
  5. 2380194Family b.36.1.0: automated matches [191362] (1 protein)
    not a true family
  6. 2380195Protein automated matches [190436] (8 species)
    not a true protein
  7. 2380209Species Human (Homo sapiens) [TaxId:9606] [187333] (101 PDB entries)
  8. 2380294Domain d5m3na2: 5m3n A:358-458 [340468]
    Other proteins in same PDB: d5m3na1, d5m3na3
    automated match to d1lcya1
    complexed with mes

Details for d5m3na2

PDB Entry: 5m3n (more details), 1.65 Å

PDB Description: htra2 wild-type structure
PDB Compounds: (A:) Serine protease HTRA2, mitochondrial

SCOPe Domain Sequences for d5m3na2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5m3na2 b.36.1.0 (A:358-458) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qrryigvmmltlspsilaelqlrepsfpdvqhgvlihkvilgspahraglrpgdvilaig
eqmvqnaedvyeavrtqsqlavqirrgretltlyvtpevte

SCOPe Domain Coordinates for d5m3na2:

Click to download the PDB-style file with coordinates for d5m3na2.
(The format of our PDB-style files is described here.)

Timeline for d5m3na2: