Lineage for d5m3na1 (5m3n A:142-343)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2387558Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 2387559Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 2387560Family b.47.1.1: Prokaryotic proteases [50495] (16 protein domains)
  6. 2387759Protein automated matches [190306] (8 species)
    not a true protein
  7. 2387787Species Human (Homo sapiens) [TaxId:9606] [322167] (8 PDB entries)
  8. 2387788Domain d5m3na1: 5m3n A:142-343 [340467]
    Other proteins in same PDB: d5m3na2, d5m3na3
    automated match to d1lcya2
    complexed with mes

Details for d5m3na1

PDB Entry: 5m3n (more details), 1.65 Å

PDB Description: htra2 wild-type structure
PDB Compounds: (A:) Serine protease HTRA2, mitochondrial

SCOPe Domain Sequences for d5m3na1:

Sequence, based on SEQRES records: (download)

>d5m3na1 b.47.1.1 (A:142-343) automated matches {Human (Homo sapiens) [TaxId: 9606]}
sprsqynfiadvvektapavvyieildrhpflgrevpisngsgfvvaadglivtnahvva
drrrvrvrllsgdtyeavvtavdpvadiatlriqtkeplptlplgrsadvrqgefvvamg
spfalqntitsgivssaqrpardlglpqtnveyiqtdaaidfgnsggplvnldgevigvn
tmkvtagisfaipsdrlreflh

Sequence, based on observed residues (ATOM records): (download)

>d5m3na1 b.47.1.1 (A:142-343) automated matches {Human (Homo sapiens) [TaxId: 9606]}
sprsqynfiadvvektapavvyieildrhpflgrevpisngsgfvvaadglivtnahvva
drrrvrvrllsgdtyeavvtavdpvadiatlriqtkeplptlplgrsadvrqgefvvamg
spfalqntitsgivssaqeyiqtdaaidfgnsggplvnldgevigvntmkvtagisfaip
sdrlreflh

SCOPe Domain Coordinates for d5m3na1:

Click to download the PDB-style file with coordinates for d5m3na1.
(The format of our PDB-style files is described here.)

Timeline for d5m3na1: