Lineage for d5lw4a_ (5lw4 A:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2017115Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2032114Superfamily b.1.18: E set domains [81296] (24 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 2033030Family b.1.18.0: automated matches [191341] (1 protein)
    not a true family
  6. 2033031Protein automated matches [190226] (54 species)
    not a true protein
  7. 2297161Species Bacillus licheniformis [TaxId:1402] [340462] (1 PDB entry)
  8. 2297162Domain d5lw4a_: 5lw4 A: [340463]
    automated match to d2yoya_

Details for d5lw4a_

PDB Entry: 5lw4 (more details)

PDB Description: nmr solution structure of the chitin-active lytic polysaccharide monooxygenase bllpmo10a
PDB Compounds: (A:) Putative chitin binding protein

SCOPe Domain Sequences for d5lw4a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5lw4a_ b.1.18.0 (A:) automated matches {Bacillus licheniformis [TaxId: 1402]}
hgfiekpgsraalcseafgflnlncgsvmyepqsleakkgfphsgpadgqiasagglfgg
ildqqsenrwfkhimtggehtftwtytaphntsqwhyyitkkgwdpdkplkradfeliga
vphdgspasrnlshhiyipedrlgyhvilavwdvadtenafyqvidvdlvnk

SCOPe Domain Coordinates for d5lw4a_:

Click to download the PDB-style file with coordinates for d5lw4a_.
(The format of our PDB-style files is described here.)

Timeline for d5lw4a_:

  • d5lw4a_ appears in periodic updates to SCOPe 2.06 starting on 2017-10-29