Lineage for d5grma1 (5grm A:155-335)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2243601Fold d.387: STING C-terminal-like [254119] (1 superfamily)
    5 helices and 5 strands in one mixed beta-sheet, one long bent helix
  4. 2243602Superfamily d.387.1: STING, TM173 CTD-like [254144] (2 families) (S)
    Pfam PF15009, PubMed 22579474
  5. 2243603Family d.387.1.1: Tyrosinase cofactor MelC1 [254191] (2 proteins)
  6. 2243635Protein automated matches [254746] (2 species)
    not a true protein
  7. 2243655Species Rattus norvegicus [TaxId:10116] [340442] (2 PDB entries)
  8. 2243656Domain d5grma1: 5grm A:155-335 [340446]
    Other proteins in same PDB: d5grma2, d5grmb2
    automated match to d4f5wa_
    complexed with 1sy

Details for d5grma1

PDB Entry: 5grm (more details), 1.55 Å

PDB Description: crystal structure of rat sting in complex with cyclic gmp-amp with 2'5'and 3'5'phosphodiester linkage(2'3'-cgamp)
PDB Compounds: (A:) Stimulator of interferon genes protein

SCOPe Domain Sequences for d5grma1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5grma1 d.387.1.1 (A:155-335) automated matches {Rattus norvegicus [TaxId: 10116]}
vahglawsyyigylklilpglqarirmfnqlhnnmlsgagsrrlyilfpldcgvpddlsv
adpnirfrdmlpqqntdragvknraysnsvyellengqpagacileyatplqtlfamsqd
gkagfsredrleqaklfcrtleeiladvpesrnhcrlivyqeseegnsfslsqevlrhir
q

SCOPe Domain Coordinates for d5grma1:

Click to download the PDB-style file with coordinates for d5grma1.
(The format of our PDB-style files is described here.)

Timeline for d5grma1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5grma2