SCOPe 2.06: Domain d5grmb1: 5grm B:155-341

Lineage for d5grmb1 (5grm B:155-341)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.387: STING C-terminal-like [254119] (1 superfamily)
   5 helices and 5 strands in one mixed beta-sheet, one long bent helix

4. Superfamily d.387.1: STING, TM173 CTD-like [254144] (2 families)
   Pfam PF15009, PubMed 22579474

5. Family d.387.1.1: Tyrosinase cofactor MelC1 [254191] (2 proteins)

6. Protein automated matches [254746] (2 species)
   not a true protein

7. Species Rattus norvegicus [TaxId:10116] [340442] (2 PDB entries)

8. Domain d5grmb1: 5grm B:155-341 [340443]
   Other proteins in same PDB: d5grma2, d5grmb2
   automated match to d4f5wa_
   complexed with 1sy

Details for d5grmb1

PDB Entry: 5grm, 1.55 Å

PDB Description: crystal structure of rat sting in complex with cyclic gmp-amp with 2'5'and 3'5'phosphodiester linkage(2'3'-cgamp)

PDB Compounds: (B:) Stimulator of interferon genes protein

SCOPe Domain Sequences for d5grmb1:

Sequence; same for both SEQRES and ATOM records:

>d5grmb1 d.387.1.1 (B:155-341) automated matches {Rattus norvegicus [TaxId: 10116]}
vahglawsyyigylklilpglqarirmfnqlhnnmlsgagsrrlyilfpldcgvpddlsv
adpnirfrdmlpqqntdragvknraysnsvyellengqpagacileyatplqtlfamsqd
gkagfsredrleqaklfcrtleeiladvpesrnhcrlivyqeseegnsfslsqevlrhir
qeekeev

Timeline for d5grmb1:

• d5grmb1 is new in SCOPe 2.06-stable
  
• d5grmb1 appears in SCOPe 2.07
  
• d5grmb1 appears in the current release, SCOPe 2.08