SCOPe 2.06: Domain d5gwsc_: 5gws C:

Lineage for d5gwsc_ (5gws C:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.0: automated matches [191313] (1 protein)
   not a true family

6. Protein automated matches [190069] (239 species)
   not a true protein

7. Species Bacillus thuringiensis [TaxId:1428] [340430] (3 PDB entries)

8. Domain d5gwsc_: 5gws C: [340441]
   automated match to d4dqxb_
   complexed with nad, sin

Details for d5gwsc_

PDB Entry: 5gws, 2.35 Å

PDB Description: 4-hydroxyisoleucine dehydrogenase complexed with nadh and succinate

PDB Compounds: (C:) 4-hydroxyisolecuine dehydrogenase

SCOPe Domain Sequences for d5gwsc_:

Sequence, based on SEQRES records:

>d5gwsc_ c.2.1.0 (C:) automated matches {Bacillus thuringiensis [TaxId: 1428]}
iimisgansgighacikyfleksfhvialdinnnnlidymktdmplkvvqidlsnseaih
nlftqldleklspdilinaagireitpvlhlsddmfkkvidvnlvapfilsrevakrwce
skikgcivniasvsglmaeperaayvaskhaligltkqmamefgkqnirvnsispgvirt
elteeyfsnkalmsmiksnqsldtwglpqdivscieylisdqarfitgsnfvidggwtag

Sequence, based on observed residues (ATOM records):

>d5gwsc_ c.2.1.0 (C:) automated matches {Bacillus thuringiensis [TaxId: 1428]}
iimisgansgighacikyfleksfhvialdinnnnlmplkvvqidlsnseaihnlftqld
leklspdilinaagireitpvlhlsddmfkkvidvnlvapfilsrevakrwceskikgci
vniasvsglmaeperaayvaskhaligltkqmamefgkqnirvnsispgvisnqsldtwg
lpqdivscieylisdqarfitgsnfvidggwtag

Timeline for d5gwsc_:

• d5gwsc_ is new in SCOPe 2.06-stable
  
• d5gwsc_ appears in SCOPe 2.07
  
• d5gwsc_ appears in the current release, SCOPe 2.08