Lineage for d5gl8b_ (5gl8 B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2114950Fold c.41: Subtilisin-like [52742] (1 superfamily)
    3 layers: a/b/a, parallel beta-sheet of 7 strands, order 2314567; left-handed crossover connection between strands 2 & 3
  4. 2114951Superfamily c.41.1: Subtilisin-like [52743] (3 families) (S)
  5. 2114952Family c.41.1.1: Subtilases [52744] (14 protein domains)
  6. 2115138Protein automated matches [190073] (15 species)
    not a true protein
  7. 2115184Species Bacillus subtilis [TaxId:86029] [195839] (3 PDB entries)
  8. 2297139Domain d5gl8b_: 5gl8 B: [340440]
    automated match to d3vyva_
    complexed with ca

Details for d5gl8b_

PDB Entry: 5gl8 (more details), 1.8 Å

PDB Description: the crystal structure of nattokinase fragments
PDB Compounds: (B:) Subtilisin NAT

SCOPe Domain Sequences for d5gl8b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5gl8b_ c.41.1.1 (B:) automated matches {Bacillus subtilis [TaxId: 86029]}
aqsvpygisqikapalhsqgytgsnvkvavidsgidsshpdlnvrggasfvpsetnpyqd
gsshgthvagtiaalnnsigvlgvapsaslyavkvldstgsgqyswiingiewaisnnmd
vinmslggpsgstalktvvdkavssgivvaaaagnegssgststvgypakypstiavgav
nssnqrasfssvgseldvmapgvsiqstlpggtygayngtsmatphvagaaalilskhpt
wtnaqvrdrlestatylgnsfyygkglinvqaaaq

SCOPe Domain Coordinates for d5gl8b_:

Click to download the PDB-style file with coordinates for d5gl8b_.
(The format of our PDB-style files is described here.)

Timeline for d5gl8b_:

  • d5gl8b_ appears in periodic updates to SCOPe 2.06 starting on 2017-10-29