Lineage for d5h43a_ (5h43 A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2006336Fold a.118: alpha-alpha superhelix [48370] (25 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2006337Superfamily a.118.1: ARM repeat [48371] (26 families) (S)
  5. 2006338Family a.118.1.1: Armadillo repeat [48372] (7 protein domains)
  6. 2006450Protein automated matches [190070] (4 species)
    not a true protein
  7. 2006457Species Human (Homo sapiens) [TaxId:9606] [187211] (12 PDB entries)
  8. 2297137Domain d5h43a_: 5h43 A: [340438]
    automated match to d3knda_

Details for d5h43a_

PDB Entry: 5h43 (more details), 2.3 Å

PDB Description: structural and mechanistical studies of the nuclear import by importin-alpha
PDB Compounds: (A:) Importin subunit alpha-1

SCOPe Domain Sequences for d5h43a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5h43a_ a.118.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
nqgtvnwsvddivkginssnvenqlqatqaarkllsrekqppidniiraglipkfvsflg
rtdcspiqfesawaltniasgtseqtkavvdggaipafisllasphahiseqavwalgni
agdgsvfrdlvikygavdpllallavpdmsslacgylrnltwtlsnlcrnknpappidav
eqilptlvrllhhddpevladtcwaisyltdgpnerigmvvktgvvpqlvkllgaselpi
vtpalraignivtgtdeqtqvvidagalavfpslltnpktniqkeatwtmsnitagrqdq
iqqvvnhglvpflvsvlskadfktqkeavwavtnytsggtveqivylvhcgiieplmnll
takdtkiilvildaisnifqaaeklgeteklsimieecggldkiealqnhenesvykasl
sliekyfs

SCOPe Domain Coordinates for d5h43a_:

Click to download the PDB-style file with coordinates for d5h43a_.
(The format of our PDB-style files is described here.)

Timeline for d5h43a_:

  • d5h43a_ appears in periodic updates to SCOPe 2.06 starting on 2017-10-29