Lineage for d3edwx_ (3edw X:)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2190102Fold d.117: Thymidylate synthase/dCMP hydroxymethylase [55830] (1 superfamily)
    contains large mixed beta-sheet
  4. 2190103Superfamily d.117.1: Thymidylate synthase/dCMP hydroxymethylase [55831] (2 families) (S)
    automatically mapped to Pfam PF00303
  5. 2190104Family d.117.1.1: Thymidylate synthase/dCMP hydroxymethylase [55832] (4 protein domains)
  6. 2190399Protein automated matches [190469] (15 species)
    not a true protein
  7. 2190448Species Human (Homo sapiens) [TaxId:9606] [189245] (20 PDB entries)
  8. 2297120Domain d3edwx_: 3edw X: [340421]
    automated match to d4eb4a_
    complexed with so4

Details for d3edwx_

PDB Entry: 3edw (more details)

PDB Description: replacement of val3 in human thymidylate synthase affects its kinetic properties and intracellular stability
PDB Compounds: (X:) Thymidylate synthase

SCOPe Domain Sequences for d3edwx_:

Sequence, based on SEQRES records: (download)

>d3edwx_ d.117.1.1 (X:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
pphgelqylgqiqhilrcgvrkddrtgtgtlsvfgmqaryslrdefpllttkrvfwkgvl
eellwfikgstnakelsskgvkiwdangsrdfldslgfstreegdlgpvygfqwrhfgae
yrdmesdysgqgvdqlqrvidtiktnpddrriimcawnprdlplmalppchalcqfyvvn
selscqlyqrsgdmglgvpfniasyalltymiahitglkpgdfihtlgdahiylnhiepl
kiqlqreprpfpklrilrkvekiddfkaedfqiegynphptikme

Sequence, based on observed residues (ATOM records): (download)

>d3edwx_ d.117.1.1 (X:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
pphgelqylgqiqhilrcgvrkddrtgtgtlsvfgmqaryslrdefpllttkrvfwkgvl
eellwfikgstnakelreegdlgpvygfqwrhfgaeyrdmesdysgqgvdqlqrvidtik
tnpddrriimawnprdlplmalppchalcqfyvvnselscqlyqrsgdmglgvpfniasy
alltymiahitglkpgdfihtlgdahiylnhieplkiqlqreprpfpklrilrkvekidd
fkaedfqiegynphptikme

SCOPe Domain Coordinates for d3edwx_:

Click to download the PDB-style file with coordinates for d3edwx_.
(The format of our PDB-style files is described here.)

Timeline for d3edwx_:

  • d3edwx_ appears in periodic updates to SCOPe 2.06 starting on 2017-10-29