Lineage for d6b6mb2 (6b6m B:87-156)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2179269Fold d.72: Cyanase C-terminal domain [55233] (1 superfamily)
    intertwined dimer of alpha-beta(2) motifs ; 2 layers, alpha/beta
  4. 2179270Superfamily d.72.1: Cyanase C-terminal domain [55234] (2 families) (S)
    automatically mapped to Pfam PF02560
  5. 2179356Family d.72.1.0: automated matches [271343] (1 protein)
    not a true family
  6. 2179357Protein automated matches [271344] (1 species)
    not a true protein
  7. 2179358Species Serratia proteamaculans [TaxId:399741] [271345] (2 PDB entries)
  8. 2297110Domain d6b6mb2: 6b6m B:87-156 [340411]
    Other proteins in same PDB: d6b6ma1, d6b6mb1, d6b6mc1, d6b6md1, d6b6me1
    automated match to d4y42a2

Details for d6b6mb2

PDB Entry: 6b6m (more details), 1.91 Å

PDB Description: cyanase from serratia proteamaculans
PDB Compounds: (B:) cyanate hydratase

SCOPe Domain Sequences for d6b6mb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6b6mb2 d.72.1.0 (B:87-156) automated matches {Serratia proteamaculans [TaxId: 399741]}
gvptdptiyrfyemvqiygstlkalvheqfgdgiisainfkldikkvpdpdggeravitl
dgkylptkpf

SCOPe Domain Coordinates for d6b6mb2:

Click to download the PDB-style file with coordinates for d6b6mb2.
(The format of our PDB-style files is described here.)

Timeline for d6b6mb2:

  • d6b6mb2 appears in periodic updates to SCOPe 2.06 starting on 2017-10-29