Lineage for d5xi7c2 (5xi7 C:246-440)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2180205Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
    core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
  4. 2180489Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (2 families) (S)
  5. 2180490Family d.79.2.1: Tubulin, C-terminal domain [55308] (4 protein domains)
  6. 2180597Protein automated matches [227071] (5 species)
    not a true protein
  7. 2180710Species Sus barbatus [TaxId:41807] [278826] (6 PDB entries)
  8. 2297108Domain d5xi7c2: 5xi7 C:246-440 [340409]
    Other proteins in same PDB: d5xi7a1, d5xi7b1, d5xi7c1, d5xi7d1, d5xi7e_, d5xi7f1, d5xi7f2
    automated match to d4i50a2
    complexed with acp, ca, gdp, gtp, mes, mg, po7

Details for d5xi7c2

PDB Entry: 5xi7 (more details), 2.99 Å

PDB Description: crystal structure of t2r-ttl bound with po-7
PDB Compounds: (C:) Tubulin alpha chain

SCOPe Domain Sequences for d5xi7c2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5xi7c2 d.79.2.1 (C:246-440) automated matches {Sus barbatus [TaxId: 41807]}
galnvdltefqtnlvpyprihfplatyapvisaekayheqlsvaeitnacfepanqmvkc
dprhgkymaccllyrgdvvpkdvnaaiatiktkrsiqfvdwcptgfkvginyqpptvvpg
gdlakvqravcmlsnttaiaeawarldhkfdlmyakrafvhwyvgegmeegefsearedm
aalekdyeevgvdsv

SCOPe Domain Coordinates for d5xi7c2:

Click to download the PDB-style file with coordinates for d5xi7c2.
(The format of our PDB-style files is described here.)

Timeline for d5xi7c2:

  • d5xi7c2 appears in periodic updates to SCOPe 2.06 starting on 2017-10-29