Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies) core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest |
Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (2 families) |
Family d.79.2.1: Tubulin, C-terminal domain [55308] (4 proteins) |
Protein automated matches [227071] (5 species) not a true protein |
Species Sus barbatus [TaxId:41807] [278826] (7 PDB entries) |
Domain d5xi5c2: 5xi5 C:246-440 [340404] Other proteins in same PDB: d5xi5a1, d5xi5b1, d5xi5c1, d5xi5d1, d5xi5e_, d5xi5f1, d5xi5f2 automated match to d4i50a2 complexed with acp, ca, gdp, gtp, mes, mg, pn6 |
PDB Entry: 5xi5 (more details), 2.81 Å
SCOPe Domain Sequences for d5xi5c2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5xi5c2 d.79.2.1 (C:246-440) automated matches {Sus barbatus [TaxId: 41807]} galnvdltefqtnlvpyprihfplatyapvisaekayheqlsvaeitnacfepanqmvkc dprhgkymaccllyrgdvvpkdvnaaiatiktkrsiqfvdwcptgfkvginyqpptvvpg gdlakvqravcmlsnttaiaeawarldhkfdlmyakrafvhwyvgegmeegefsearedm aalekdyeevgvdsv
Timeline for d5xi5c2: