Lineage for d5xi7f1 (5xi7 F:1-76)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2106806Fold c.30: PreATP-grasp domain [52439] (1 superfamily)
    3 layers: a/b/a; parallel or mixed beta-sheet of 4 to 6 strands
    possible rudiment form of Rossmann-fold domain
  4. 2106807Superfamily c.30.1: PreATP-grasp domain [52440] (10 families) (S)
    precedes the ATP-grasp domain common to all superfamily members, can contain a substrate-binding function
  5. 2107090Family c.30.1.9: Tubulin tyrosine ligase (TTL) N-terminal domain-like [310625] (1 protein)
  6. 2107091Protein Tubulin tyrosine ligase (TTL) N-terminal domain [310727] (2 species)
  7. 2107092Species Chicken (Gallus gallus) [TaxId:9031] [311384] (45 PDB entries)
  8. 2297083Domain d5xi7f1: 5xi7 F:1-76 [340384]
    Other proteins in same PDB: d5xi7a1, d5xi7a2, d5xi7b1, d5xi7b2, d5xi7c1, d5xi7c2, d5xi7d1, d5xi7d2, d5xi7e_, d5xi7f2
    automated match to d3tiia1
    complexed with acp, ca, gdp, gtp, mes, mg, po7

Details for d5xi7f1

PDB Entry: 5xi7 (more details), 2.99 Å

PDB Description: crystal structure of t2r-ttl bound with po-7
PDB Compounds: (F:) tubulin tyrosine ligase

SCOPe Domain Sequences for d5xi7f1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5xi7f1 c.30.1.9 (F:1-76) Tubulin tyrosine ligase (TTL) N-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]}
mytfvvrdenssvyaevsrlllatgqwkrlrkdnprfnlmlgernrlpfgrlghepglvq
lvnyyrgadklcrkas

SCOPe Domain Coordinates for d5xi7f1:

Click to download the PDB-style file with coordinates for d5xi7f1.
(The format of our PDB-style files is described here.)

Timeline for d5xi7f1:

  • d5xi7f1 appears in periodic updates to SCOPe 2.06 starting on 2017-10-29