SCOPe 2.06: Domain d5xhcc2: 5xhc C:246-440

Lineage for d5xhcc2 (5xhc C:246-440)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
   core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest

4. Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (2 families)

5. Family d.79.2.1: Tubulin, C-terminal domain [55308] (4 proteins)

6. Protein automated matches [227071] (5 species)
   not a true protein

7. Species Sus barbatus [TaxId:41807] [278826] (7 PDB entries)

8. Domain d5xhcc2: 5xhc C:246-440 [340379]
   Other proteins in same PDB: d5xhca1, d5xhcb1, d5xhcc1, d5xhcd1, d5xhce_, d5xhcf1, d5xhcf2
   automated match to d4i50a2
   complexed with 87u, acp, ca, gdp, gtp, mes, mg

Details for d5xhcc2

PDB Entry: 5xhc, 2.75 Å

PDB Description: crystal structure of t2r-ttl-po10 complex

PDB Compounds: (C:) Tubulin alpha chain

SCOPe Domain Sequences for d5xhcc2:

Sequence; same for both SEQRES and ATOM records:

>d5xhcc2 d.79.2.1 (C:246-440) automated matches {Sus barbatus [TaxId: 41807]}
galnvdltefqtnlvpyprihfplatyapvisaekayheqlsvaeitnacfepanqmvkc
dprhgkymaccllyrgdvvpkdvnaaiatiktkrsiqfvdwcptgfkvginyqpptvvpg
gdlakvqravcmlsnttaiaeawarldhkfdlmyakrafvhwyvgegmeegefsearedm
aalekdyeevgvdsv

Timeline for d5xhcc2:

• d5xhcc2 is new in SCOPe 2.06-stable
  
• d5xhcc2 appears in SCOPe 2.07
  
• d5xhcc2 appears in the current release, SCOPe 2.08