Lineage for d5xi7e_ (5xi7 E:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2012335Fold a.137: Non-globular all-alpha subunits of globular proteins [48661] (14 superfamilies)
    not a true fold
  4. 2012522Superfamily a.137.10: Stathmin [101494] (1 family) (S)
    single long helix crosslinking four tubulin subunits
    automatically mapped to Pfam PF00836
  5. 2012523Family a.137.10.1: Stathmin [101495] (2 protein domains)
  6. 2012524Protein Stathmin 4 [101496] (1 species)
  7. 2012525Species Norway rat (Rattus norvegicus) [TaxId:10116] [101497] (66 PDB entries)
  8. 2297076Domain d5xi7e_: 5xi7 E: [340377]
    Other proteins in same PDB: d5xi7a1, d5xi7a2, d5xi7b1, d5xi7b2, d5xi7c1, d5xi7c2, d5xi7d1, d5xi7d2, d5xi7f1, d5xi7f2
    automated match to d4i55e_
    complexed with acp, ca, gdp, gtp, mes, mg, po7

Details for d5xi7e_

PDB Entry: 5xi7 (more details), 2.99 Å

PDB Description: crystal structure of t2r-ttl bound with po-7
PDB Compounds: (E:) Stathmin-4

SCOPe Domain Sequences for d5xi7e_:

Sequence, based on SEQRES records: (download)

>d5xi7e_ a.137.10.1 (E:) Stathmin 4 {Norway rat (Rattus norvegicus) [TaxId: 10116]}
mevielnkctsgqsfevilkppsfdgvpefnaslprrrdpsleeiqkkleaaeerrkyqe
aellkhlaekrehereviqkaieennnfikmakeklaqkmesnkenreahlaamlerlqe
kdkhaeevrknkelke

Sequence, based on observed residues (ATOM records): (download)

>d5xi7e_ a.137.10.1 (E:) Stathmin 4 {Norway rat (Rattus norvegicus) [TaxId: 10116]}
mevielnkctsgqsfevilkppdpsleeiqkkleaaeerrkyqeaellkhlaekrehere
viqkaieennnfikmakeklaqkmesnkenreahlaamlerlqekdkhaeevrknkelke

SCOPe Domain Coordinates for d5xi7e_:

Click to download the PDB-style file with coordinates for d5xi7e_.
(The format of our PDB-style files is described here.)

Timeline for d5xi7e_:

  • d5xi7e_ appears in periodic updates to SCOPe 2.06 starting on 2017-10-29