SCOPe 2.08: Domain d5xhcd2: 5xhc D:244-431

Lineage for d5xhcd2 (5xhc D:244-431)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
   core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest

4. Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (2 families)

5. Family d.79.2.1: Tubulin, C-terminal domain [55308] (4 proteins)

6. Protein automated matches [227071] (7 species)
   not a true protein

7. Species Sus barbatus [TaxId:41807] [278826] (7 PDB entries)

8. Domain d5xhcd2: 5xhc D:244-431 [340373]
   Other proteins in same PDB: d5xhca1, d5xhcb1, d5xhcc1, d5xhcd1, d5xhce_, d5xhcf1, d5xhcf2, d5xhcf3
   automated match to d3rycd2
   complexed with 87u, acp, ca, gdp, gtp, mes, mg

Details for d5xhcd2

PDB Entry: 5xhc, 2.75 Å

PDB Description: crystal structure of t2r-ttl-po10 complex

PDB Compounds: (D:) Tubulin beta chain

SCOPe Domain Sequences for d5xhcd2:

Sequence, based on SEQRES records:

>d5xhcd2 d.79.2.1 (D:244-431) automated matches {Sus barbatus [TaxId: 41807]}
gqlnadlrklavnmvpfprlhffmpgfapltsrgsqqyraltvpeltqqmfdsknmmaac
dprhgryltvaaifrgrmsmkevdeqmlnvqnknssyfvewipnnvktavcdipprglkm
satfignstaiqelfkriseqftamfrrkaflhwytgegmdemefteaesnmndlvseyq
qyqdatad

Sequence, based on observed residues (ATOM records):

>d5xhcd2 d.79.2.1 (D:244-431) automated matches {Sus barbatus [TaxId: 41807]}
gqlnadlrklavnmvpfprlhffmpgfaplltvpeltqqmfdsknmmaacdprhgryltv
aaifrgrmsmkevdeqmlnvqnknssyfvewipnnvktavcdipprglkmsatfignsta
iqelfkriseqftamfrrkaflhwytgegmdemefteaesnmndlvseyqqyqdatad

Timeline for d5xhcd2:

• d5xhcd2 first appeared in SCOPe 2.06
  
• d5xhcd2 appears in SCOPe 2.07