Lineage for d5xfia_ (5xfi A:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2068877Fold b.77: beta-Prism I [51091] (3 superfamilies)
    consists of 3 4-stranded sheets; strands are parallel to the 3-fold axis
    duplication: has internal pseudo threefold symmetry
  4. 2068917Superfamily b.77.3: Mannose-binding lectins [51101] (2 families) (S)
  5. 2068918Family b.77.3.1: Mannose-binding lectins [51102] (7 protein domains)
  6. 2068947Protein Calystegia sepium agglutinin [101948] (1 species)
  7. 2068948Species Hedge bindweed (Calystegia sepium) [TaxId:47519] [101949] (3 PDB entries)
  8. 2297067Domain d5xfia_: 5xfi A: [340368]
    automated match to d1ouwb_
    complexed with bez, bma, edo, gal, man, nag, so4

Details for d5xfia_

PDB Entry: 5xfi (more details), 1.65 Å

PDB Description: crystal structure of calsepa lectin in complex with biantennary n- glycan
PDB Compounds: (A:) lectin

SCOPe Domain Sequences for d5xfia_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5xfia_ b.77.3.1 (A:) Calystegia sepium agglutinin {Hedge bindweed (Calystegia sepium) [TaxId: 47519]}
avpmdtisgpwgnnggnfwsfrpvnkinqivisyggggnnpialtfsstkadgskdtitv
ggggpdsitgtemvnigtdeyltgisgtfgiyldnnvlrsitfttnlkahgpygqkvgtp
fssanvvgneivgflgrsgyyvdaigtynrhk

SCOPe Domain Coordinates for d5xfia_:

Click to download the PDB-style file with coordinates for d5xfia_.
(The format of our PDB-style files is described here.)

Timeline for d5xfia_:

  • d5xfia_ appears in periodic updates to SCOPe 2.06 starting on 2017-10-29