Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) |
Family c.47.1.0: automated matches [191312] (1 protein) not a true family |
Protein automated matches [190056] (165 species) not a true protein |
Species Mycobacterium thermoresistibile [TaxId:1078020] [340365] (1 PDB entry) |
Domain d6ap5a1: 6ap5 A:9-115 [340366] Other proteins in same PDB: d6ap5a2 automated match to d4xhmb_ |
PDB Entry: 6ap5 (more details)
SCOPe Domain Sequences for d6ap5a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6ap5a1 c.47.1.0 (A:9-115) automated matches {Mycobacterium thermoresistibile [TaxId: 1078020]} msgtvtvtdstfktdvldsdtpvlvdfwadwcgpckmvapvleeianeksgtlkvakldv danpeaardfqvvsiptmilfkggtpvkrivgakgkaallreiedal
Timeline for d6ap5a1: