Lineage for d6ap5a1 (6ap5 A:9-115)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2131616Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2131617Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2133854Family c.47.1.0: automated matches [191312] (1 protein)
    not a true family
  6. 2133855Protein automated matches [190056] (165 species)
    not a true protein
  7. 2134746Species Mycobacterium thermoresistibile [TaxId:1078020] [340365] (1 PDB entry)
  8. 2134747Domain d6ap5a1: 6ap5 A:9-115 [340366]
    Other proteins in same PDB: d6ap5a2
    automated match to d4xhmb_

Details for d6ap5a1

PDB Entry: 6ap5 (more details)

PDB Description: h, 13c, and 15n chemical shift assignments and structure of thioredoxin from mycobacterium thermoresistibile atcc 19527 and nctc 10409
PDB Compounds: (A:) thioredoxin

SCOPe Domain Sequences for d6ap5a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6ap5a1 c.47.1.0 (A:9-115) automated matches {Mycobacterium thermoresistibile [TaxId: 1078020]}
msgtvtvtdstfktdvldsdtpvlvdfwadwcgpckmvapvleeianeksgtlkvakldv
danpeaardfqvvsiptmilfkggtpvkrivgakgkaallreiedal

SCOPe Domain Coordinates for d6ap5a1:

Click to download the PDB-style file with coordinates for d6ap5a1.
(The format of our PDB-style files is described here.)

Timeline for d6ap5a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d6ap5a2